SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000016206 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000016206
Domain Number 1 Region: 201-377
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-26
Family Laminin G-like module 0.0075
Further Details:      
 
Domain Number 2 Region: 29-180
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.06e-21
Family Laminin G-like module 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000016206   Gene: ENSBTAG00000012219   Transcript: ENSBTAT00000016206
Sequence length 2319
Comment pep:known chromosome:UMD3.1:21:33574740:33610470:1 gene:ENSBTAG00000012219 transcript:ENSBTAT00000016206 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRWGPRLPLPALALALALTFAVLVGPASTASFFGENHLEVPVATALTDIDLQLEFSTAQP
EALLLLAAGPADYLLLQLYSGRLQVRLLLGQEEVRVQTPAEMLLSDSVPHIVELTVSDSW
ALLSVDGLLNDSAPVQGAPLEVPYGLFLGGTGSLDLPYLTRASRPLRGCLHSATLNGRSL
LRPLTADVPEGCAEEFSAGDDVAVGFSGPYSLAAFPAWGTRHEGTLEFTLTTRSQKAPLA
FQAGGRQGDFIYVDIFEGHLRAVVEKGQGTVLLHNSMPVADGQPHEVSVHVDVHRLEISV
DQYPTRTSNRGVLSYLEPRGNLLLGGLDAEASRHLQEHRLGLAVNVSLLGCMEDLSVNGQ
RQGLREALLTRNMAAGCRLEEDEYEEDAYGPYEAFSTLAPEVWSAMELPVPCVPEPGLPP
VFANFTQLLTVSPLVVAEGGTAWLEWRHVQPTLDLNEAELRKSQVLFSVSRGARHGELEL
DIPGAQARKMFTLLDVVNRKARFVHDGSEDPSDQLVLEVSVTSRGAVPSCLRRGQTYILP
IQVNPVNDPPRVIFPHGSLMVILEHTQKPLGPEVFQAYDPDSVCEGLTFQLLGAPAGLPV
ERRDQPGEPATEFSCRELEAGSLVYVHRGGPAPDLTFRVSDGLQASPPVTLKVVAVRPAI
QVLHNTGLRLAQGFAAPVLPANLSVETNAVGQDVSVLFRVTGALRLGELQKQGAGGAEGT
EWRSTRAFHQRDVEQGRIRYLSTDPQHHAEDTVESVALEVQVGQEALSNLTFPVMIQRAT
VRLLRLEPLHTQNTQQEALTTAHLEATLEEAGPNPTTFHYEVVQAPRKGNLQLQGTRLSD
GQSFTQDDLRAGRVTYGATARASEAVEDAFRFRVTAPPHFSPLYTFPIHIGGDPDAPVLT
NVLLSVPEGGKGILSADHLFVKSLNSANYLYEVMERPRHGRLVWRDTQDEATMVTSFTNE
DLLHGRLVYQHDNSETTEDDIPFVATRQGEGSSDMAWEEVRGVFRVAIQPVNDHAPVQTI
SRIFHVARGGQRLLTTDDVAFSDADSGFADAQLVLTRKDLLFGSIVAVDEPSRPIYRFTQ
EDLRNRRVLFVHSGADRGWIQLQVSDGQHQATALLEVQASEPYLRVTNGSGLVVPQGGQG
TIDTDVLPLDTNLDIRSGDEVHYQVTAGPRWGQLLRAGQPVTSFTQQDLLERAILYNHNG
SLSPRDTLAFSVESGPVHTEATLQVTIAVEGPVAPLHLAQHKKIYVFQGEAAEIRRDLLE
AAQEAVPPADIVFSVKTQPSAGYLVMLSPGAVAAEPPSLDPVNRFSQEAVDAGRVLYLHS
RPEVWSDTFSLDVSSGLGAPLEGVRVELEVLPAAIPLEAQNFSVPEGGARTLAPPLLRIA
GSYFPTLPALLLQVLEPPRHGALQREEGPQDGSLSAFSWREVEQQLIRYVHDGSETVEDS
FVLVANASEMDRQSHPVVLTITILPVNDQPPILTTNTGLQMWEGATVPIPAEALRGTDSD
SGPEDLVYTLEQPSNGRVVLSTAPGTETHSFTQAQLDGGLVLFSHRGALDGGFRFSLSDG
EHSSAGHFFRVTAQKQLLLSLEGSRTLTVCPGSVQPLSSQSLRASSSAGTDPHHLLYRVL
RGPQLGRLFHTQRGSTREALENFTQAEVYAGNILYEHEMPSEPFWEAHDALELQLSSPPA
PDMVATLAVTVTFEAACPQRPSRLWRNKGLWVSEGQRAEITTAALDAANLLASIPSPRRL
EHDVLFQITQFPTRGQLLVSEEPLHAGRPHFLQSELATGQLVYAHGGGGTQQDGFRFRAH
LQGPAGASVVGPQTSEVFAITVRDVNERPPQPQASIPLRLTRGSRSPVSRAQLSVVDPDS
APGEIEYEVQRAPHNGFLSLAGASPGPVTRFTQADVDAGRLVFVANGSSVVGVFQLSVSD
GASPPLLMSLAVDVLPSAIEVQLRAPLEVPQALGRSSLSRQQLRVVSDREEPDAAYRLTQ
GPRYGHLLVGGQPATAFSQLQVDQGDVVFAFTNFSSSQDQFSILALARGANASATVNVTV
RALLHVWTGGPWPQGATLRLDPTVLDAGELANRTGSVPRFRLLAGPRHGRVVRVPRARTE
PRGGQLVEQFTQRDLEDGRLGLEVGRPEGSSPGPTGDSLTLELWARGVPPAVASLDFATE
PFNAARTYRVALLSLPEAARTEAGEPESGTPTGGPSPATPSPVPPVASGGFLGFLEANMF
SIIIPICLVLLLLALIVPLLFYLRKRNKTGKHNVQVLTAKPRNGLASDAETFRKVEPGQA
IPLTAVPGQGPPPGGQPDPELLQFCRTANPALKNGQYWV
Download sequence
Identical sequences F1MY84
ENSBTAP00000016206 NP_001179711.1.59421 NP_001179711.1.76553 ENSBTAP00000016206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]