SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000016226 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000016226
Domain Number 1 Region: 54-369
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.94e-75
Family Glycosyl hydrolases family 35 catalytic domain 0.00029
Further Details:      
 
Domain Number 2 Region: 488-622
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 9.07e-26
Family Beta-galactosidase LacA, domains 4 and 5 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000016226   Gene: ENSBTAG00000012229   Transcript: ENSBTAT00000016226
Sequence length 635
Comment pep:novel chromosome:UMD3.1:15:84899737:84926047:1 gene:ENSBTAG00000012229 transcript:ENSBTAT00000016226 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQAFLFLVRLAGLLSLTSRFLVTSALQEGLPESVVEALLRPSHVSERLVGLQVRGSNFTL
GNMPFLILSGTIHYFRVPRDYWKDSLLKLKACGFNTVTTHVPWNLHEPRRGQFHYSGNLD
LIAFISLASEVDLWVILCVGPYIGSDLDLGGLPSWLLKDSHMKLRTTHKGFTAAVNRYFD
DLIPKIRGFQFQEEGPIIAMQMENEYGSYNLDKRYMPYIKNALLSRGIKTMLMTADTGQG
LLKGHTPTVFATLHMKSIRQKTYEHLSSAQVRTAQRRGVFSFISGNSWGPSPPSPPPAVL
MESVREMLKLRFSLNFYMFHGGTNFGFTGGAAFPGHRLPMVTSYDYGALLTEDGGYTPEY
LVFQEFFRRVPSFQHQDHRPKDTYAPLAAGHFISLWDTLIHQDDEPVRSTGPLSMEQLSV
NEGSGQSAGYILYETVITRGGILNSDGHVKDRGQVFLDDKYIGVLDDTHQKLTLPSDHYK
EFLTLRILVENQGRLASGTSMNQERKGLTGNIYLNGSPLRKFKIYSLEMQNKFIQRKLPN
IWKPSFLHTVGPAFFLALLRVGSQPKDTFMSLQGWTKGVVFINGQNLGRYWNVGPQETLY
VPGPWLKPGLNEIIVFEEFKSTLLIYFTNTSQLGY
Download sequence
Identical sequences E1BGB7
ENSBTAP00000016226 ENSBTAP00000016226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]