SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000016231 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000016231
Domain Number 1 Region: 61-366
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.42e-95
Family Glycosyl hydrolases family 35 catalytic domain 0.000034
Further Details:      
 
Domain Number 2 Region: 483-615
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.41e-24
Family Beta-galactosidase LacA, domains 4 and 5 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000016231   Gene: ENSBTAG00000018390   Transcript: ENSBTAT00000016231
Sequence length 635
Comment pep:known_by_projection chromosome:UMD3.1:15:84972313:85011313:1 gene:ENSBTAG00000018390 transcript:ENSBTAT00000016231 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKWSVRRRPSLLLGAVLLIVCLPVLRRLDWSGLGASLWRRRHLGLRADGQNFKLENSAF
WIFGGSVHYFRVPRAYWRDRLLKLRACGLNTLTTYVPWNLHEPERGTFDFSGNLDLEAFI
LLAAEVGLWVILRPGPYICSEVDLGGLPSWLLRDPDMRLRTTYKGFTEAVDLYFDHLMLR
VVPLQYKHGGPIIAVQVENEYGSYNKDPAYMPYIKKALQDRGIAELLLTSDNQGGLKSGV
LDGVLATINLQSQSELQLFTTILLGAQGSQPKMVMEYWTGWFDSWGGPHYILDSSEVLNT
VSAIVKAGSSINLYMFHGGTNFGFIGGAMHFQDYKPDVTSYDYDAVLTEAGDYTAKYTKL
REFFGSMAGAPLPVPPDLLPKTAYDPVTPAFYVSLWDALNFLELPVTSEHPVNMENLPIN
GGSGQSFGYTLYETTITASGVLTALVRDRGQVFLNTFFLGTLDYKKKTIVIPTVQGFTTL
RILVENCGRVNYGDNIDQQRKGIIGNVYLNDSPLKKFKIYSLEMDRSFLQRFTADKWKPL
TEEPMFPAFFLGALSVLDSPYDTFVKLEGWEKGVVFINNQNLGRYWNIGPQETLYLPGAW
LDVGLNKIIVFEEKMAQRIIQFVDTPNLGQHEYVH
Download sequence
Identical sequences F1MY73
XP_005194800.1.59421 XP_005216677.1.76553 ENSBTAP00000016231 ENSBTAP00000016231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]