SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000016317 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000016317
Domain Number 1 Region: 23-298
Classification Level Classification E-value
Superfamily L domain-like 2.53e-56
Family Ngr ectodomain-like 0.000000445
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000016317   Gene: ENSBTAG00000012302   Transcript: ENSBTAT00000016317
Sequence length 446
Comment pep:known_by_projection chromosome:UMD3.1:19:23559326:23560666:-1 gene:ENSBTAG00000012302 transcript:ENSBTAT00000016317 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSPPGCCVELLLLLLAGELPLGSGCPRDCVCYPAPMTVSCQAHNFAAIPEGIPEDSERIF
LQNNHITLLRQGHFSPAMVTLWIYSNNITFIDPNTFQGFVHLEELDLGDNRQLRTLAPET
FQGLVKLHALYLYKCGLSALPAGIFGGLHSLQYLYLQDNHIEYLQDDIFVDLVNLSHLFL
HGNKLWSLGQDTFRGLVNLDRLLLHENQLQWVHHKAFHDLRRLTTLFLFNNSLSELPGDC
LAPLGALEFLRLNGNAWDCGCRARSLWEWLQRFRGSSSAVPCVSPERLHGQDLKLLRAED
FWNCTGPASPHQIKSHTLTTTDRAARKEHHPPHHGPARDKGHPHGHLPGSRSGSKKPGKN
CTSHRNRNQVSKAGSGKQAPELQDYAPDYQHKFSFDFMPTSRPKRKGKCARRTPIRAPSG
VQQASLGTSLRASLLAWILGLVVTLR
Download sequence
Identical sequences E1BEI7
ENSBTAP00000016317 ENSBTAP00000016317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]