SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000016333 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000016333
Domain Number 1 Region: 305-595
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.56e-77
Family Protein kinases, catalytic subunit 0.000000285
Further Details:      
 
Domain Number 2 Region: 152-238
Classification Level Classification E-value
Superfamily Kringle-like 1.62e-34
Family Kringle modules 0.00048
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000016333
Domain Number - Region: 11-98
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.0017
Family Frizzled cysteine-rich domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000016333   Gene: ENSBTAG00000012312   Transcript: ENSBTAT00000016333
Sequence length 714
Comment pep:known_by_projection chromosome:UMD3.1:3:81672267:81712707:-1 gene:ENSBTAG00000012312 transcript:ENSBTAT00000016333 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FRDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKC
SQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKL
PNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNS
QYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENYKFDLCDIPACAPREKNKM
EILYILVPSVAIPLAIALLFFFICVCRNNQKSSSPPVQRQPKHVRGQNVEMSMLNAYKPK
SKAKELPLSAVRFMEELGECAFGKIYKGHLYLPGMDHAQLVAIKTLKDYNNPQQWTEFQQ
EASLMAELHHPNIVCLLGAVTQEQPVCMLFEYMNQGDLHEFLIMRSPHSDVGCSSDEDGT
VKSSLDHGDFLHIAIQIAAGMEYLSSHFFVHKDLAARNILIGEQLHVKISDLGLSREIYS
ADYYRVQSKSLLPIRWMPPEAIMYGKFSSDSDIWSFGVVLWEIFSFGLQPYYGFSNQEVI
EMVRKRQLLPCSEDCPPRMYSLMTECWNEIPSRRPRFKDIHVRLRSWEGLSSHTSSTTPS
GGNATTQTTSLSASPVSNLSNPRYPNYMFPSQGITPQGQIAGFISPPIPQNQRFIPINGY
PIPPGYAAFPAAHYQPAGPPRVIQHCPPPKSRSPSSASGSTSTGHVTSLPSSGS
Download sequence
Identical sequences F1MZ64
ENSBTAP00000016333 9913.ENSBTAP00000016333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]