SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000016342 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000016342
Domain Number 1 Region: 400-663
Classification Level Classification E-value
Superfamily YWTD domain 3.27e-52
Family YWTD domain 0.000000000296
Further Details:      
 
Domain Number 2 Region: 284-396,697-713
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000029
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 3 Region: 142-182
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000017
Family LDL receptor-like module 0.00019
Further Details:      
 
Domain Number 4 Region: 26-63
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000119
Family LDL receptor-like module 0.00015
Further Details:      
 
Domain Number 5 Region: 104-144
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000196
Family LDL receptor-like module 0.0002
Further Details:      
 
Domain Number 6 Region: 236-274
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000034
Family LDL receptor-like module 0.00018
Further Details:      
 
Domain Number 7 Region: 198-234
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000524
Family LDL receptor-like module 0.00026
Further Details:      
 
Domain Number 8 Region: 66-104
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000016342   Gene: ENSBTAG00000012314   Transcript: ENSBTAT00000016342
Sequence length 845
Comment pep:known chromosome:UMD3.1:7:16768644:16802349:1 gene:ENSBTAG00000012314 transcript:ENSBTAT00000016342 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLAGWGLRWAIALLIAVGEAAVEDNCGRNEFQCQDGKCISYKWVCDGTAECQDGSDESQ
ETCKSVTCKMGDFSCGGRVNRCISGSWRCDGQVDCENGSDEEGCSPKTCSQDEFRCNDGK
CIAPKFVCDLDLDCLDGSDEASCPMPTCGPANFQCNSSMCIPQLWACDGDPDCDDGSDEW
PKHCGTPHPSGPLQDNNPCSALEFHCGSGECIHSSWHCDHDPDCKDKSDEENCAVATCRP
DEFQCSDGTCIHGSRQCDREPDCKDLSDELGCVNVTLCEGPNKFKCQSGECISLDKVCNS
VRDCRDWSDEPLKDCGTNECLDNKGGCSHICNDLKIGYECLCPEGFQLVGKHRCEDIDEC
QNPDTCSQLCVNLEGSYKCECEEGFRLEPLTKACKAVGTIAYLFFTNRHEVRKMTLDRSE
YTSLIPNLKNVVALDTEVASNRIYWSDLSQRKIYSAQIDGAPGFSSYDTVIGEDLQAPDG
LAVDWIHSNIYWTDSILGTVSVADTKGVKRKTLFQEEGSKPRAIVVDPVHGFMYWTDWGA
PAEIKKGGLNGVDVYSLVTEDIQWPNGITLDLSGGRLYWVDSKLHSISSIDVNGGNRKTV
LEDKKKLAHPFSLAIFEDKVFWTDVINEAIFSANRLTGSDISLMAENLLSPEDIVLFHNL
TQPRGVNWCERTALRNGGCQYLCLPAPQINPRSPKFTCACPDGMLLAKDMRSCLTESESA
VTTRGPSTVSSTAVGPKRTASPELTTAESVTMSQQGQGDIASQADTERPGSVGALYIVLP
IALLILLAFGTFLLWKNWRLKSINSINFDNPVYQKTTEDEVHICRSQDGYTYPSRQMVSL
EDDVA
Download sequence
Identical sequences P01131
ENSBTAP00000016342 NP_001160002.1.59421 NP_001160002.1.76553 ENSBTAP00000016342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]