SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000016391 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000016391
Domain Number 1 Region: 132-234
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.54e-27
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000016391   Gene: ENSBTAG00000012351   Transcript: ENSBTAT00000016391
Sequence length 513
Comment pep:known chromosome:UMD3.1:21:26874338:26962870:1 gene:ENSBTAG00000012351 transcript:ENSBTAT00000016391 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVSGRILDLKTGTVKKEGQQSSMRMCMGSRRSFICRMRCGNAPLDHLPLNRLTTMRKRFR
NGLGPVKEGEAQYAVVHCTGYIKAWPPAVKLIPWPNSELVSGPHPCLVTISPFQVTSSPV
CMDMSGMSVPTEFLSRHNSDGIITFVDPRCISVIGYQPQDLLGKDILEFCHSEDQSHLRE
SFQQVVKLKGQVLSVMYRFRTKNREWVLIRTSSFTFQNPYSDEIEYIICTNTNVKQLQQQ
QAELEVHQRDGLSSYDLSQVPVPNLPAGVHDAGKSVEKADAIFSQERDPRFAEMFAGISA
SEKKMMSSASAAGTQQIYSQGSPFPAGHSGKAFSSAVVHVPGVNDIQSSSSTSQNMSQIS
RQLNQSQVAWTGSRPPFPGQQLPSQSSKTQSSPFGIGTSHTYPADPSSYSPLSSPATSSP
SGNAYSSLANRTPGFAESGQSSGQFQGRPSEVWSQWQSQHHGQQSGEPHSHQQPGQTEVF
QDMLPMPGDPTQGTGNYNIEDFADLGMFPPFSP
Download sequence
Identical sequences F1MYL2
ENSBTAP00000016391 ENSBTAP00000016391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]