SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000016410 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000016410
Domain Number 1 Region: 3-153
Classification Level Classification E-value
Superfamily L domain-like 9.01e-30
Family U2A'-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000016410   Gene: ENSBTAG00000012365   Transcript: ENSBTAT00000016410
Sequence length 249
Comment pep:known chromosome:UMD3.1:10:15589747:15629076:-1 gene:ENSBTAG00000012365 transcript:ENSBTAT00000016410 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDMDKRIHLELRNRTPSDVKELVLDNCRSNEGKIEGLTDEFEELEFLSTINVGLTSVANL
PKLNKLKKLELSDNRISGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDL
FNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDDEEDEDEEEYD
EDAQVVEDEEDEEEEEEGEEEDVSGEEEEDEEGYNDGEVDDEEDEEELGEEERGQKRKRE
PEDEGEDDD
Download sequence
Identical sequences P51122
NP_001181948.1.59421 NP_001181948.1.76553 XP_004010315.1.66739 XP_005893366.1.15283 XP_006054837.1.26621 XP_010832807.1.44457 XP_011985812.1.54773 XP_020736161.1.74333 ENSBTAP00000016410 ENSBTAP00000016410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]