SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000016545 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000016545
Domain Number 1 Region: 401-716
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.11e-76
Family Eukaryotic proteases 0.00013
Further Details:      
 
Domain Number 2 Region: 24-138
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.76e-33
Family Spermadhesin, CUB domain 0.0000159
Further Details:      
 
Domain Number 3 Region: 184-296
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-31
Family Spermadhesin, CUB domain 0.0000258
Further Details:      
 
Domain Number 4 Region: 300-370
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000222
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 5 Region: 134-182
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000878
Family EGF-type module 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000016545   Gene: ENSBTAG00000012467   Transcript: ENSBTAT00000016545
Sequence length 728
Comment pep:known chromosome:UMD3.1:1:80596924:80649363:1 gene:ENSBTAG00000012467 transcript:ENSBTAT00000016545 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRWLLLSHALCFSLLKASAHIVELNNMFGQIQSPGYPDAYPSDSEVTWNITVPEGFRIKL
YFMHFNLESSYLCEYDYVKVETEDQVLATFCGRETTDTEQTPGQEVVLSPGSFMSITFRS
DFSDEERFTGFDAHYVAVDVDECTEREDEELSCDHYCHNYIGGYYCSCRFGYILHTDNRT
CRVECSDNLFTQRTGVITSPDFPSPYPKSSECLYTIELEEGFMISLQFEDIFDIEDHPEV
SCPYDYIKIKAGPKVLGPFCGEKAPEPINTQSHSIQILFRSDNSGENRGWRLSYRATGNE
CPKLQPPVHGKIEPLQTTYSFKDQVLISCDTGYKVLKDNVEMDTFQMECLKDGTWSSKIP
TCKIADCGAPAELENGVVTFSTRNNLTTYKSEIRYSCQRPYYKMLHNTTGVYTCSAQGVW
MNEVLGRSQPTCLPVCGQPSRSLPNLVKRIIGGRNAEPGLFPWQALIVVEDTSRVPNDKW
FGSGALLSESWILTAAHVLRSQRRDNTVTPVSKEHVTVHLGLHDVRDKSGAVNSSAARVV
LHPDFNIQSYNHDIALVQLREPVPLGPHILPVCLPPPEPAGPAPHVLGLVAGWGISNPNV
TVDEIIGSGTRTLSDVLQYVKLPVVPHAECKTSYESRSGNYSVTENMFCAGYYEGGKDTC
LGDSGGAFVILDDASQRWVAQGLVSWGGPEECGSKQVYGVYTKVSNYVDWVWEQMGSPQG
LGELQVER
Download sequence
Identical sequences F1MVS9
ENSBTAP00000016545 9913.ENSBTAP00000016545 XP_005899709.1.15283 ENSBTAP00000016545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]