SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000016614 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000016614
Domain Number 1 Region: 112-495
Classification Level Classification E-value
Superfamily L domain-like 3.26e-53
Family Ngr ectodomain-like 0.0011
Further Details:      
 
Domain Number 2 Region: 397-635
Classification Level Classification E-value
Superfamily L domain-like 2.18e-41
Family Ngr ectodomain-like 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000016614   Gene: ENSBTAG00000012514   Transcript: ENSBTAT00000016614
Sequence length 661
Comment pep:known_by_projection chromosome:UMD3.1:3:93728705:93751305:-1 gene:ENSBTAG00000012514 transcript:ENSBTAT00000016614 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGAHARGAQPRLGKKLRPVAGQRSAPRTRGQLSQPRSLGESELTPPAGTMAQGWALLLL
LLLPRQLGVVLAVRAPGFGRSGARSLSPEENEFSEEEPVLVLSPEEPGRGPATIGCPRDC
ACSQEGVVDCGGIDLREFPGDLPEHTNHLSLQNNQLEKIYPRELSRLHRLETLNLQNNRL
TSRGLPEEAFEHLTNLNYLYLANNKLTLAPRFLPNALISVDFAANYLTKIYGLTFGQKPN
LRSVYLHNNKLADAGLPDNMFNGSSNVEILILSSNFLRHVPKHLPPALYKLHLKNNKLEK
IPPGAFSELSNLRELYLQNNHLTDEGLDNETFWKLSSLEYLDLSSNNLSRVPAGLPRSLV
LLHLEKNAIRSVDADVLTPIRSLEYLLLHSNQLRAQGIHPRAFQGLKRLHTVHLYNNALE
RVPSGLPRRVRTLMILHNQITGVGRDDFATTYHLEELNLSYNRITSPRVHRDAFRKLRLL
RSLDLSGNRLHTLPPGLPRNVHVLKIKRNELVALARGALAGMAQLRELYLTGNRLRNRAL
GPRAWTDLSGLQLLDIAGNQLTEIPGGLPESLEYLYLQNNKISAVPANAFDSTPNLKGIF
LRFNKLAVGSVVESAFRKLKHLQVLDIEGNFEFGDVSKDRGRLEKEEEEEDDDEEEEEER
R
Download sequence
Identical sequences E1BHH6
ENSBTAP00000016614 ENSBTAP00000016614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]