SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000016767 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000016767
Domain Number 1 Region: 414-720
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.76e-55
Family Eukaryotic proteases 0.00085
Further Details:      
 
Domain Number 2 Region: 123-239
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.53e-32
Family Spermadhesin, CUB domain 0.00054
Further Details:      
 
Domain Number 3 Region: 280-350
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000132
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 4 Region: 234-274
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000271
Family EGF-type module 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000016767   Gene: ENSBTAG00000012630   Transcript: ENSBTAT00000016767
Sequence length 720
Comment pep:known chromosome:UMD3.1:15:66754734:66832246:-1 gene:ENSBTAG00000012630 transcript:ENSBTAT00000016767 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELGWWPQLGLAFLQLLLISSLPREYTVINEACPGAEWNIMCRECCEYDQIKCECPGKKE
VVGYTIPCCRNEENECDSCLIHPGCTIFENCKTCRNGSWGGTLDDFYVKGIYCAECRAGW
YGGDCMRCGQVLRVPKGQILLESYPLNAHCEWTIHAKPGFIIQLRIVMLSLEFDYMCQYD
YVEVRDGDSSDSQIIKRFCGNERPAPIRSTGSSLHILFHSDGSKNFDGFHAIFEEITACS
SSPCFHDGTCLLDSTGSYKCACLAGYTGKHCENLLEERNCSDPGGPVNGYKKITGGPGLI
HGHYAKIGTVLTFFCNSSYVLSGNEMRTCQQNGEWSGKQPICIKACREPKISDLVRRKVL
PMQVQSRETPLHQLYSSAFSKQKLQDAPTKKPVLPFGDLPPGYQHLHTQLQYECISPFYR
RLGSSRRTCLRTGKWSGRAPSCIPICGKTENVSAPKTQGTRWPWQAAIYRRAGGVHGGGL
HKDAWFLVCSGALVNERTVVVAAHCVTDLGRVTVIKTADLKVVLGKFYRDDDRDEKSIQS
LRISAIILHPNYDPILLDMDIAILKLLDKARMSTRVQPICLAAPRDLSTSFQESRITVAG
WNVLADSRSPGYKDDTLRSGVVRVADSLLCEEQHEAQGIPVSVTDSMFCAGRDPTAPSDI
CTAETGGIAAVSFPGRASPEPRWHLVGLVSWSYDKTCSHSLSTAFTKVLPFKDWIERNMK
Download sequence
Identical sequences F1MUJ4
ENSBTAP00000016767 9913.ENSBTAP00000016767 ENSBTAP00000016767 XP_019831282.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]