SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000016790 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000016790
Domain Number 1 Region: 161-467
Classification Level Classification E-value
Superfamily Cysteine proteinases 5.97e-69
Family Papain-like 0.000016
Further Details:      
 
Domain Number 2 Region: 93-157
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000816
Family VWC domain 0.068
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000016790
Domain Number - Region: 73-108
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00119
Family Somatomedin B domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000016790   Gene: ENSBTAG00000012652   Transcript: ENSBTAT00000016790
Sequence length 476
Comment pep:known chromosome:UMD3.1:23:5953509:6059979:-1 gene:ENSBTAG00000012652 transcript:ENSBTAT00000016790 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCAGYKILILAYLTTEIWMERQYLSQREVDPGAEFTRNHTISEGTRFKRAVFEGQYCRRF
GCCADRDDGCVTQFYEADALCYCDKFCERENSDCCPDYKSFCREEKGWPPRTKPWSPEGC
HRDGQHYEEGSVIKENCNSCTCSGQQWKCSQHVCLVQPGLIEHVNKGDYGWTAQNYSQFW
GMTLEEGFKYRLGTLPPSPLLLSMNEVTASLTKTTDLPEFFIASYKWPGWTHGPLDQKNC
AASWAFSTASVAADRIAIQSQGRYTANLSPQNLISCCAKKRHGCNSGSVDRAWWYLRKRG
LVSHACYPLFKDQNATNNGCAMASRSDGRGKRHATTPCPNSIEKSNRIYQCSPPYRVSSN
ETEIMREIMQNGPVQAIMQVHEDFFNYKTGIYRHITSTNEDSEKYRKFRTHAVKLTGWGT
LRGAQGQKEKFWIAANSWGKSWGENGYFRILRGVNESDIEKLIIAAWGQLTSADEP
Download sequence
Identical sequences Q3SZI1
NP_001030279.1.59421 NP_001030279.1.76553 ENSBTAP00000016790 ENSBTAP00000016790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]