SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000016858 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000016858
Domain Number 1 Region: 996-1290
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.2e-80
Family Protein kinases, catalytic subunit 0.0000000000697
Further Details:      
 
Domain Number 2 Region: 333-498
Classification Level Classification E-value
Superfamily L domain-like 3.4e-52
Family L domain 0.0000000867
Further Details:      
 
Domain Number 3 Region: 34-194
Classification Level Classification E-value
Superfamily L domain-like 3.69e-43
Family L domain 0.000000108
Further Details:      
 
Domain Number 4 Region: 495-618
Classification Level Classification E-value
Superfamily Fibronectin type III 2.61e-33
Family Fibronectin type III 0.000000161
Further Details:      
 
Domain Number 5 Region: 802-944
Classification Level Classification E-value
Superfamily Fibronectin type III 1.19e-23
Family Fibronectin type III 0.00000313
Further Details:      
 
Domain Number 6 Region: 622-702,808-832
Classification Level Classification E-value
Superfamily Fibronectin type III 2.83e-19
Family Fibronectin type III 0.000003
Further Details:      
 
Domain Number 7 Region: 179-335
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000173
Family Growth factor receptor domain 0.000000044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000016858   Gene: ENSBTAG00000012687   Transcript: ENSBTAT00000016858
Sequence length 1382
Comment pep:known chromosome:UMD3.1:7:17280452:17403052:-1 gene:ENSBTAG00000012687 transcript:ENSBTAT00000016858 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CLPGGRVGKATHSYKPSMGCLLTCLALCLFALPVCPGMDIRNNLTRLHELANCSVIEGHL
QILLMFKTRPEDFRDLSFPKLIMITDYLLLFRVYGLESLKDLFPNLTVIRGSRLFFNYAL
VIFEMVHLKELGLYNLMNITRGSVRIEKNNELCYLATIDWSRILDSVEDNYIVLNKDDNE
ECGDICPGTAKGKTNCPATVINGQFVERCWTHSHCQKVCPTICKSHGCTSEGLCCHSECL
GNCSEPDDPTKCVACRNFYLDGRCVETCPPPYYHFQDWRCVNFSFCQDLHNKCKNSRRQG
CHQYVIHNNKCIPECPSGYTMNSSNLMCTPCLGPCPKVCHLLEGEKTIDSVTSAQELRGC
TIINGSLIINIRGGNNLAAELEANLGLIEEISGYLKIRRSYALVSLSFFRKLRLIRGETL
EIGNYSFYALDNQNLRQLWDWSKHNLTITQGKLFFHYNPKLCLSEIHKMEEVSGTKGRQE
RNDIALKTNGDQASCENELLKFSYIRTSYDKILLKWEPYWPPDFRDLLGFMLFYKEAPYQ
NVTEFDGQDACGSNSWTVVDIDPPTRSNDPKSQNHPGWLMRGLKPWTQYAIFVKTLVTFS
DERRTYGAKSDIIYVQTDATNPSVPLDPISVSNSSSQIILKWKPPSDPNGNITHYLVFWE
RQAEDSELYELDYCLKGLKLPSRTWSPPFESEGSQKHNQSEYEESAGECCSCPKTDSQIL
KELEESSFRKTFEDYLHNVVFIPRKSSSGPVAEDARPSRKRRALGDVGNVTAAVPTALGL
PNTSSTSTPMSSEEHRPFEKVVNKESLVISGLRHFTGYRIELQACNQDSPEERCSVAAYV
SARTMPEAKADDIVGPVTHEIFENNVVHLMWQEPKEPNGLIVLYEVSYRRYGEEELHLCV
SRRHYALERGCRLRGLLPGNYSVRVRATSLAGNGSWTEATYFYVTDYLDVPSNIAKIIIG
PLIFVFLFSVVIGSICLFLRKRQPDGPLGPLYASSNPEYLSASDVFPCSVYVPDEWEVPR
EKITLLRELGQGSFGMVYEGNARDIVKGEAETRVAVKTVNESASLRERIEFLNEASVMKG
FTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMA
AEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPV
RWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDN
CPERVTDLMRMCWQFNPKMRPTFLEIVDLLKDDLHPSFPEVSFFHSEENKAPESEELEME
FEDMESVPLDRASHAQREEAGGRDGGSALGLKRNYDEHIPYTHMNGGKKNGRILTLPRSN
PS
Download sequence
Identical sequences F1MV64
ENSBTAP00000016858 ENSBTAP00000016858

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]