SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000016884 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000016884
Domain Number 1 Region: 17-178
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 1.07e-35
Family Glyoxalase I (lactoylglutathione lyase) 0.0000000653
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000016884   Gene: ENSBTAG00000012703   Transcript: ENSBTAT00000016884
Sequence length 184
Comment pep:known chromosome:UMD3.1:23:12483468:12509232:-1 gene:ENSBTAG00000012703 transcript:ENSBTAT00000016884 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEPQPASGGLTDEAALSCCSDPDPSTKDFLLQQTMLRIKDPKKSLDFYTRILGMTLLQK
LDFPTMKFSLYFLAYEDKNDIPKDKDEKVAWVFSRKATLELTHNWGTEDDETQSYHSGNS
DPRGFGHIGIAVPDVHGACKRFEELGIKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNTM
ITII
Download sequence
Identical sequences A4FUZ1
ENSBTAP00000016884 NP_001076965.1.59421 NP_001076965.1.76553 ENSBTAP00000016884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]