SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000017013 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000017013
Domain Number 1 Region: 422-684
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.77e-75
Family Eukaryotic proteases 0.0000000338
Further Details:      
 
Domain Number 2 Region: 27-136
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.01e-30
Family Spermadhesin, CUB domain 0.00000131
Further Details:      
 
Domain Number 3 Region: 184-295
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.19e-27
Family Spermadhesin, CUB domain 0.00000215
Further Details:      
 
Domain Number 4 Region: 366-435
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000306
Family Complement control module/SCR domain 0.0000243
Further Details:      
 
Domain Number 5 Region: 300-369
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000667
Family Complement control module/SCR domain 0.0000811
Further Details:      
 
Domain Number 6 Region: 135-181
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000323
Family EGF-type module 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000017013   Gene: ENSBTAG00000012808   Transcript: ENSBTAT00000017013
Sequence length 686
Comment pep:known_by_projection chromosome:UMD3.1:16:43463199:43478362:1 gene:ENSBTAG00000012808 transcript:ENSBTAT00000017013 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRLLVFLGLLWGLVAASSGPQWPKPVFGRLASPGFPDKYANNQERRWALTAPPGYRLRLY
FTHFQLEPSYLCEYDFVKLSAGTKELATLCGSESTDTERAPGNDTFYSPGSSLDVTFRSD
YSNEKPFTGFEAFYSAEDIDECQVPPGEAPTCDHHCHNHLGGFYCSCRVGYVLHRNKRTC
SALCSDQVFTARSGELSSPEYPQPYPKLSSCTYSIHLEEGFHVILDFVESFDVETHPETL
CPYDSLKIRTDKAEYGPFCGKTLPSRIETKSNTVTITFTTDQSGDHMGWKVRYNSTAEPC
PDPLAPPNGRISPVQAKYILKDHFSVFCETGYELLQGNLPLKSFAAVCQKDGSWDRPMPV
CSIVDCGPPDDLPSGQVEYITGPAVTTYRAVVKYRCNEFYTMTTNDGKYVCEADGFWTSS
KREKSLPVCEPVCGISTRTTEGRIYGGQNAKLGYFPWQVLLLGKTMAAGALLYDNWILTA
AHAVYDQREDTASLQIRMGALKRISPNYTQAWAEAIFIHESYIHDAGYDNDIALIKLKNK
VAINSNIMPICLPRKEAESFMRTNDIGTASGWGLTQRGFLARNLKFIDIPVVDHQKCTAA
YEKKSYPEGRVTDNMLCAGLQSGGKDSCRGDSGGALVFLDNETQKWFVGGIVSWGSINCG
EADQYGVYTKVINYIPWIKSIINSNF
Download sequence
Identical sequences E1BJ49
ENSBTAP00000017013 ENSBTAP00000017013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]