SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000017076 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000017076
Domain Number 1 Region: 878-1182
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.4e-93
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000000526
Further Details:      
 
Domain Number 2 Region: 1140-1441
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 9.9e-80
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000142
Further Details:      
 
Domain Number 3 Region: 25-186
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-35
Family MAM domain 0.00000575
Further Details:      
 
Domain Number 4 Region: 386-585
Classification Level Classification E-value
Superfamily Fibronectin type III 6.74e-28
Family Fibronectin type III 0.00078
Further Details:      
 
Domain Number 5 Region: 284-420
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000114
Family Fibronectin type III 0.0032
Further Details:      
 
Domain Number 6 Region: 189-282
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000734
Family I set domains 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000017076   Gene: ENSBTAG00000012848   Transcript: ENSBTAT00000017076
Sequence length 1446
Comment pep:known_by_projection chromosome:UMD3.1:2:124819576:124906896:-1 gene:ENSBTAG00000012848 transcript:ENSBTAT00000017076 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARAQALFLALTFQLCAPETETPAAGCTFEETSDPAVPCEYSQAQYDDFQWEQVRIHPGT
RAPADLPHGSYLVVNASQHAPGQRAHVIFQSLSENDTHCVQFSYFLYSRDGHSPGTLGIY
VRVNGGPLGSAVWNMTGSHGRQWHQAELAVSTFWPNEYQVLFEALVSPDRRGYMGLDDIL
LLSYPCAKAPHFSRLGDVEVNAGQNASFQCMAAGRAAEAERFLLQRQSGALVPAAGVRHI
SHRRFLATFPLVAVSREDQDLYRCVSQAPRGAGVSNFAELIVKEPPTPIAPPQLLRAGPT
YLIIQLNTNSIIGDGPIVRKEIEYRMARGPWAEVHAVSLQTYKLWHLDPDTEYEISVLLT
RPGDGGTGRPGPPLVSRTKCAEPMRAPKGLAFAEIQARQLTLQWEPLGYNVTRCHTYSVS
LCYHYTLGSSHNQTVRECVKMERGVSRYTIKNLLPYRNVHVRLVLTNPEGRKEGKEVTFQ
TDEDVPGGIAAESLTFTPLEDMIFLKWEEPQEPNGLITQYEISYQSVESSDPAVNVPGPR
RTISKLRNETYHVFSNLHPGTTYLFSVRARTGKGFGQAALTEITTNISAPSFDYADMPSP
LGESENTITVLLRPAQGRGAPISVYQVIVEEERPRRLRREPGSQDCFPVPLTFDAALARG
LVHYFGAELAASSLPEAMPFTVGDNQTYRGFWNPPLEPRKAYLIYFQAASHLKGETRLNC
IRLARKAACKESKQPLEVSQRSEEMGLILGICAGGLAVLILLLGAIIIIIRKGRNHYAYS
YYPKPVNMTKATVNYRQEKTHMMSAVDRSFTDQSTLQEDERLGLSFMDAHGYSPRGDQRG
SGVTEASSLLGGSPRRPCGRKGSPYHTGQLHPAVRVADLLQHINQMKTAEGYGFKQEYES
FFEGWDATKKKDKVKGGRQEPMPAYDRHRVKLHPMLGDPDADYINANYIDGYHRSNHFIA
TQGPKPEMVYDFWRMVWQEHCSSIVMITKLVEVGRVKCSRYWPEDSDMYGDIKITLVKTE
TLAEYVVRSFALERRGYSARHEVRQFHFTAWPEHGVPYHATGLLAFIRRVKASTPPDAGP
VVIHCSAGTGRTGCYIVLDVMLDMAECEGVVDIYNCVKTLCSRRVNMIQTEEQYIFIHDA
ILEACLCGETTIPVSEFKATYKEMIRIDPQSNSSQLREEFQTLNSVTPPLDVEECSIALL
PRNRDKNRSMDVLPPDRCLPFLVSTDGDPNNYINAALTDSYTRSAAFIVTLHPLQSTTPD
FWRLVYDYGCTSIVMLNQLHQSNSAWPCPQYWPEPGRQQYGLMEVEFVSGTADEDLVARV
FRVQNISRMQEGHLLVRHFQFLRWSAYRDTPDSKKAFLHLLAAVDKWQAESGDGRTIVHC
LNGGGRSGTFCACATVLEMIRCHNLVDVFFAAKTLRNYKPNMVETLDQYHFCYDVALEYL
EGLESR
Download sequence
Identical sequences F1MD22
NP_001178423.1.59421 NP_001178423.1.76553 ENSBTAP00000017076 ENSBTAP00000017076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]