SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000017120 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000017120
Domain Number 1 Region: 21-215
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.02e-34
Family Pentraxin (pentaxin) 0.000000883
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000017120   Gene: ENSBTAG00000012884   Transcript: ENSBTAT00000017120
Sequence length 217
Comment pep:known chromosome:UMD3.1:3:10579369:10582728:-1 gene:ENSBTAG00000012884 transcript:ENSBTAT00000017120 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKLLLGVLLLAFLPEGMTQKDLRGKVFIFPEQSDTAYVTLIPRVRKPLRSFTLCLKAFT
DLTRPYSLFSYSTKSKDNELLLFVNKVGEYELHIGNTKVTFKVPRPPYGPVHLCVSWESV
SGIAELWMNSRPVGRKGLRRGYTLGQDARIILGQEQDSFGGKFDAKQSFVGEIWDVSLWD
HVVSLKNLCFTCYTSNILNWKALIYQAKGYVVVKPKL
Download sequence
Identical sequences Q3T166
ENSBTAP00000017120 9913.ENSBTAP00000017120 ENSBTAP00000017120 NP_001029399.1.59421 NP_001029399.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]