SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000017322 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000017322
Domain Number 1 Region: 428-781
Classification Level Classification E-value
Superfamily L domain-like 6.8e-54
Family Internalin LRR domain 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000017322   Gene: ENSBTAG00000013030   Transcript: ENSBTAT00000017322
Sequence length 810
Comment pep:known chromosome:UMD3.1:11:99411393:99437846:1 gene:ENSBTAG00000013030 transcript:ENSBTAT00000017322 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIPVTELRYFADTQPAYRILKPWWDVFTDYISIVMLMIAVFGGTLQVTQDKMICLPCKWV
TKDSCNDSFRGWAAPGPEPPYPNSTIGPTPDSGPTGIKYDLDRHQYNYVDAVCYENRLHW
FAKYFPYLVLLHTLIFLACSNFWFKFPRTSSKLEHFVSILLKCFDSPWTTRALSETVVEE
SDPKPAFSKMNGSMDKKSSTVSEDVEATVPMLQRTKSRIEQGIVDRSETGVLDKKEGEQA
KALFEKVKKFRTHVEEGDIVYRLYMRQTIIKVIKFILIICYTVYYVHNIKFDVDCTVDIE
SLTGYRTYRCAHPLATLFKILASFYISLVIFYGLICMYTLWWMLRRSLKKYSFESIREES
SYSDIPDVKNDFAFMLHLIDQYDPLYSKRFAVFLSEVSENKLRQLNLNNEWTLDKLRQRL
TKNAQDKLELHLFMLSGIPDTVFDLVELEVLKLELIPDVTIPPSIAQLTGLKELWLYHTA
AKIEAPALAFLRENLRALHIKFTDIKEIPLWIYSLKTLEELHLTGNLSAENNRFIVIDGL
RELKRLKVLRLKSNLSKLPQVVTDVGVHLQKLSINNEGTKLIVLNSLKKMANLTELELIR
CDLERIPHSIFSLHNLQEIDLKDNNLKTIEEIISFQHLHRLTCLKLWYNHIAYIPIQIGN
LTNLERLYLNRNKIEKIPTQLFYCRKLRYLDLSHNNLTFLPADIGLLQSLQNLAVTANRI
EALPPELFQCRKLRALHLGNNVLQSLPSRVGELTSLTQIELRGNRLECLPVELGECPLLK
RSGLVVEEDLFNTLPPEVKERLWRADKEQA
Download sequence
Identical sequences L8HRD1 Q08E42
9913.ENSBTAP00000017322 ENSBTAP00000017322 ENSBTAP00000017322 NP_001070275.1.59421 NP_001070275.1.76553 XP_005213260.1.76553 XP_005908836.1.15283 XP_005908837.1.15283 XP_006065395.1.26621 XP_006065396.1.26621 XP_006065397.1.26621 XP_006065398.1.26621 XP_006065399.1.26621 XP_006065400.1.26621 XP_006065401.1.26621 XP_006065402.1.26621 XP_010855120.1.44457 XP_010855121.1.44457 XP_010855122.1.44457 XP_010855123.1.44457 XP_010855124.1.44457 XP_019826542.1.53367 XP_019826543.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]