SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000017341 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000017341
Domain Number 1 Region: 1-167
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.41e-38
Family L-arabinose binding protein-like 0.0000256
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000017341   Gene: ENSBTAG00000013047   Transcript: ENSBTAT00000017341
Sequence length 480
Comment pep:known chromosome:UMD3.1:22:18740484:19056230:-1 gene:ENSBTAG00000013047 transcript:ENSBTAT00000017341 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GFDAYFTSRTLENNRRNVWFAEYWEENFNCKLTISGSKKEDTDRKCTGQERIGKDSNYEQ
EGKVQFVIDAVYAMAHALHHMNKDLCADYRGVCPEMEQAGGKKLLKYIRNVNFNGDAGTP
VMFNKNGDAPGRYDIFQYQTTNTTNPGYRLIGQWTDELQLNIEDMQWGKGVREIPASVCT
MPCKPGQRKKTQKGTPCCWTCEPCDGYQYQFDEMTCQHCPYDQRPNENRTGCQDIPIIKL
EWHSPWAVIPVFLAMLGIIATIFVMATFIRYNDTPIVRASGRELSYVLLTGIFLCYIITF
LMIAKPDVAVCSFRRVFLGLGMCISYAALLTKTNRIYRIFEQGKKSVTAPRLISPTSQLA
ITSSLISVQLLGVFIWFGVDPPNIIIDYDEHKTMNPEQARGVLKCDITDLQIICSLGYSI
LLMVTCTVYAIKTRGVPENFNEAKPIGFTMYTTCIVWLAFIPIFFGTAQSAEKCLVCYVS
Download sequence
Identical sequences H7BWV8
ENSBTAP00000017341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]