SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000017354 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSBTAP00000017354
Domain Number - Region: 238-362
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000283
Family APC10-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000017354   Gene: ENSBTAG00000013056   Transcript: ENSBTAT00000017354
Sequence length 372
Comment pep:known chromosome:UMD3.1:13:62822739:62843246:-1 gene:ENSBTAG00000013056 transcript:ENSBTAT00000017354 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRSSRSPEDSCDQPENVAHVSREVRPRRIIQRGRNICRMTEAPLSNASDAFLLPVRINA
PGLTQCMLECVSWITCLACFLRTRAHRVLFNTCRYKLFIHKLIEKAGVLILCAFGFWMFS
VHLPSKMDIWQEDSIDSPLQSLRMYQEKVRHHTGEIQDLRGHLNQLIAKLQEMEAMSDEQ
KMTQKIIKMIQGDYIEKPDFALKSIGASIDFEQTSATYNHDKACSYWNWIRLWNYAQPPD
VILEPNVTPGNCWAFSGDRGQVTIRLAQKVYLSNLTLQHIPKTISLSGSLDTAPKDFVIY
GVEGSPKEEVFLGAFQFQPENIIQTFQLQNQPPRTFGAVKVKISSNWGNPRFTCLYRVRV
HGSVTLPREQPN
Download sequence
Identical sequences Q2YDP2
NP_001039630.1.59421 NP_001039630.1.76553 9913.ENSBTAP00000017354 ENSBTAP00000017354 ENSBTAP00000017354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]