SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000017408 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000017408
Domain Number 1 Region: 7-439
Classification Level Classification E-value
Superfamily ALDH-like 2.23e-122
Family ALDH-like 0.000000000587
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000017408   Gene: ENSBTAG00000013093   Transcript: ENSBTAT00000017408
Sequence length 468
Comment pep:known chromosome:UMD3.1:29:46188329:46203015:1 gene:ENSBTAG00000013093 transcript:ENSBTAT00000017408 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPFADTLQRLREAFVSGRTRPAEFRDAQLKGLSRFLRENKQLLQEALAQDLHKSAFEAE
VSEISISQNEINLALRNLRTWMKDEKVSKNLATQLDSAFIRKEPFGLVLILSPWNYPLNL
SLGPLVGALAAGNCVVLKPSEISKNTEKVLAEVLPRYLDQSCFAVVLGGPQETGRLLEHK
FDYIFFTGNPQVGKIVMTAAAKHLTPVTLELGGKNPCYVDDNCDPQTVANRVAFFRCFNA
GQTCVAPDYVLCSPEMQAQLVPALQSAITRFYGDDPQSSPNLGRIISQKHFQRLRGLLSC
GRVVIGGQSDECDLYIAPTVLVDVQETDPVMQEEIFGPILPIVNVRSLGQAIDFINRREK
PLALYAFSNSSQVVKRVLAQTSSGGFCGNDGFMHLTLASLPFGGVGSSGMGNYHGKFSFD
TFSHHRACLLRRPGLEKIYAIRYPPHTPRNLRVLLMAMETRSCSCTLL
Download sequence
Identical sequences Q1JPA0
NP_001068986.1.59421 NP_001068986.1.76553 XP_005227117.2.76553 XP_005227118.1.76553 XP_005227119.1.76553 ENSBTAP00000017408 ENSBTAP00000042081 ENSBTAP00000017408

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]