SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000017556 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000017556
Domain Number 1 Region: 3028-3286
Classification Level Classification E-value
Superfamily YWTD domain 6.02e-57
Family YWTD domain 0.0000016
Further Details:      
 
Domain Number 2 Region: 1269-1533
Classification Level Classification E-value
Superfamily YWTD domain 1.29e-48
Family YWTD domain 0.00000251
Further Details:      
 
Domain Number 3 Region: 1891-2151
Classification Level Classification E-value
Superfamily YWTD domain 7.59e-45
Family YWTD domain 0.0000129
Further Details:      
 
Domain Number 4 Region: 1583-1840
Classification Level Classification E-value
Superfamily YWTD domain 6.8e-44
Family YWTD domain 0.0000198
Further Details:      
 
Domain Number 5 Region: 3871-4145
Classification Level Classification E-value
Superfamily YWTD domain 8.11e-44
Family YWTD domain 0.00000531
Further Details:      
 
Domain Number 6 Region: 536-774
Classification Level Classification E-value
Superfamily YWTD domain 9.16e-41
Family YWTD domain 0.00000905
Further Details:      
 
Domain Number 7 Region: 200-464
Classification Level Classification E-value
Superfamily YWTD domain 2.35e-38
Family YWTD domain 0.0000738
Further Details:      
 
Domain Number 8 Region: 2226-2469
Classification Level Classification E-value
Superfamily YWTD domain 3.01e-34
Family YWTD domain 0.0000309
Further Details:      
 
Domain Number 9 Region: 2916-3020,3289-3341
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.18e-21
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 10 Region: 1182-1261,1526-1578
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000118
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 11 Region: 848-890
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000628
Family LDL receptor-like module 0.0000933
Further Details:      
 
Domain Number 12 Region: 3569-3609
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000103
Family LDL receptor-like module 0.00063
Further Details:      
 
Domain Number 13 Region: 929-968
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000017
Family LDL receptor-like module 0.00079
Further Details:      
 
Domain Number 14 Region: 3611-3647
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000236
Family LDL receptor-like module 0.00047
Further Details:      
 
Domain Number 15 Region: 23-63
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000249
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 16 Region: 3653-3698
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000288
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 17 Region: 3369-3409
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000393
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 18 Region: 1013-1050
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000393
Family LDL receptor-like module 0.0000983
Further Details:      
 
Domain Number 19 Region: 2692-2729
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000406
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 20 Region: 889-931
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000419
Family LDL receptor-like module 0.00056
Further Details:      
 
Domain Number 21 Region: 3487-3528
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000511
Family LDL receptor-like module 0.00078
Further Details:      
 
Domain Number 22 Region: 974-1011
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000563
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 23 Region: 3531-3570
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000011
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 24 Region: 2559-2599
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000127
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 25 Region: 107-190,477-519
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000173
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 26 Region: 2732-2766
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 27 Region: 1057-1097
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000209
Family LDL receptor-like module 0.00013
Further Details:      
 
Domain Number 28 Region: 3448-3485
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000314
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 29 Region: 2814-2850
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000812
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 30 Region: 2852-2891
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000877
Family LDL receptor-like module 0.00055
Further Details:      
 
Domain Number 31 Region: 2599-2638
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000929
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 32 Region: 3411-3449
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000107
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 33 Region: 2772-2806
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000114
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 34 Region: 3332-3366
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000131
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 35 Region: 1846-1886,2157-2207,2471-2523
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000267
Family Growth factor receptor domain 0.023
Further Details:      
 
Domain Number 36 Region: 3742-3776
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000089
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 37 Region: 2526-2567
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000196
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 38 Region: 802-847
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000259
Family EGF-type module 0.041
Further Details:      
 
Domain Number 39 Region: 1143-1178
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000393
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 40 Region: 71-106
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000419
Family LDL receptor-like module 0.0028
Further Details:      
 
Domain Number 41 Region: 1106-1140
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000681
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 42 Region: 2657-2688
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000101
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 43 Region: 3695-3731
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000209
Family LDL receptor-like module 0.0027
Further Details:      
 
Domain Number 44 Region: 3785-3831
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000433
Family EGF-type module 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000017556   Gene: ENSBTAG00000010830   Transcript: ENSBTAT00000017556
Sequence length 4544
Comment pep:known_by_projection chromosome:UMD3.1:5:56562309:56641157:-1 gene:ENSBTAG00000010830 transcript:ENSBTAT00000017556 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTPPLLLLLPLLSALVAAAVDVPKTCSPKQFACRDQITCISKGWRCDGERDCPDGSDEA
PEICPQSKAQRCQPNEHNCLGTELCILMSRLCNGVQDCADGSDEGSHCREQRGQCSHLGC
QHHCVPTLNGPTCYCNNSFQLQADGKTCKDFDECSVYGTCSQLCTNTDGSFTCGCVEGYL
LQPDNRSCKAKNEPVDRPPVLLIANSQNILATYLSGAQVSTITPTSTRQTTAMDFSYANE
TVCWVHVGDSAAQTQLKCARMPGLKGFVDEYTINISLSLHHVEQMAIDWLTGNFYFVDDI
DDRIFVCNRNGDTCVTLLDLELYNPKGIALDPAMGKVFFTDYGQIPKVERCDMDGQNRTK
LVDSKIVFPHGITLDLVSRLVYWADAYLDYIEVVDYEGKGRQTIIQGILIEHLYGLTVFE
NYLYATNSDNANAQQKTSVIRVNRFNSTDYQVVTRVDKGGALHIYHQRRQPRVRSHACEN
DQYGKPGGCSDICLLANSHKARTCRCRSGFSLGSDGKSCKKPEHELFLVYGKGRPGIIRG
MDMGAKVPDEHMIPIENLMNPRALDFHAETGFIYFADTTSYLIGRQKIDGTERETILKDG
IHNVEGVAVDWMGDNLYWTDDGPKKTISVARLEKAAQTRKTLIEGKMTHPRAIVVDPLNG
WMYWTDWEEDPKDSRRGRLERAWMDGSHRDIFVTSKTVLWPNGLSLDIPAGRLYWVDAFY
DRIETILLNGTDRKIVYEGPELNHAFGLCHHGNYLFWTEYRSGSVYRLERGTGGAAPIVT
LLRSERPPIFEIRMYDAQQQQVGTNKCRVNNGGCSSLCLATPGSRQCACAEDQVLDADGV
TCLANPSYVPPPQCQPGEFACSNSRCIQERWKCDGDNDCLDNSDEAPALCHQHTCPSDRF
KCENNRCIPNRWLCDGDNDCGNSEDESNATCSARTCPPNQFSCASGRCIPISWTCDLDDD
CGDRSDESASCAYPTCFPLTQFTCNNGRCININWRCDNDNDCGDNSDEAGCSHSCSSTQF
KCNSGRCIPEHWTCDGDNDCGDYSDETHANCTNQATRPPGGCHNDEFQCRLDGLCIPLRW
RCDGDTDCMDSSDEKSCEGVTHVCDPNVKFGCKDSARCISKAWVCDGDSDCEDNSDEENC
ESLACRPPSHPCANNTSVCLPPDKLCDGNDDCGDGSDEGELCDQCSLNNGGCSHNCSVAP
GEGIVCSCPLGMELGPDNHTCQIQSYCAKHLKCSQKCDQNKFSVKCSCYEGWVLEPDGES
CRSLDPFKPFIIFSNRHEIRRIDLHKGDYSVLVPGLRNTIALDFHLSQSALYRDVVEDKI
YRGKLLSSSALTSFEVVIQYGLATPEGLAVDWIAGNIYWVESNLDQIEVAKLDGTLRTTL
LAGDIEHPRAIALDPRDGILFWTDWDASLPRIEAASMSGAGRRTIHRETGSGGWPNGLTV
DYLEKRILWIDARSDAIYSARYDGSGHMEVLRGHEFLSHPFAVTLYGGEVYWTDWRTNTL
AKANKWTGHNVTVVQRTNTQPFDLQVYHPSRQPMAPNPCEANGGRGPCSHLCLIDYNRTV
SCACPHLMKLHKDNTTCYEFKKFLLYARQMEIRGVDLDAPYYNYIISFTVPDIDNVTVLD
YDAREQRVYWSDVRTQAIKRAFINGTGVETVVSADLPNAHGLAVDWVSRNLFWTSYDTNK
KQINVARLDGSFKNAVVQGLEQPHGLVVHPLRGKLYWTDGDNISMANMDGSNRTLLFSGQ
RGPVGLAIDFPESKLYWISSKNHTINRCNLDGSELEVIDAMRNQLGKATALAIMGDKLWW
ADQVSEKMGTCNKADGSGSVVLRNSTTLVMHMKVYDESIQLDHEGTNPCSVNNGDCSQLC
LPTSETTRSCMCTAGYSLRSGQQACEGVGSFLLYSVHEGIRGIPLDPNDKSDALVPVSGT
SLAVGIDFHAENDTIYWVDMGLSTISRAKRDQTWREDVVTNGIGRVEGIAVDWIAGNIYW
TDQGFDVIEVARLNGSFRYVVISQGLDKPRAITVHPEKGYLFWTEWGQYPRIERSRLDGS
ERVVLVNVSISWPNGISVDYQDGKLYWCDARTDKIERIDLETGEDREVVLSSNNMDMFSV
SVFEEFIYWSDRTHANGSIKRGSKDNATDSVPLRTGIGVQLKDIKVFNRDRQKGTNVCAV
DNGGCQQLCLYRGNGQRACACAHGMLAEDGASCREYAGYLLYSERTILKSVHLSDERNLN
APVQPFEDPEHMKNVIALAFDYRAGTSPGTPNRIFFSDIHFGNIQQINDDGSGRTTIVEN
VGSVEGLAYHRGWDTLYWTSYTTSTITRHTVDQTRPGAFERETVITMSGDDHPRAFVLDE
CQNLMFWTNWNEQHPSIMRAALSGANVLTLIEKDIRTPNGLAIDHRAEKLYFSDATLDKI
ERCEYDGSHRYVILKSEPVHPFGLAVYGEHIFWTDWVRRAVQRANKYVGSDMKLLRVDIP
QQPMGIIAVANDTNSCELSPCRINNGGCQDLCLLTHQGHVNCSCRGGRILQDDFTCQAVN
SSCRAQDEFECANGECINFGLTCDGVSHCKDKSDEKPSYCNTRRCKKTFRQCNNGRCVSN
MLWCNGADDCGDGSDEIPCNKTACGVGEFRCRDGTCIGNSSRCNQFVDCEDASDEMNCSA
TDCSSYFRLGVKGVRFQPCERTSLCYAPSWVCDGANDCGDYSDERDCPGVKRPRCPLNYF
ACPSGRCIPMSWTCDKEDDCEHGEDETHCNKFCSEAQFECQNHRCISKQWLCDGSDDCGD
GSDEAAHCEGKTCGPGSFSCPGTHVCVPERWLCDGDKDCADGADESVAAGCLYNSTCDDR
EFMCQNRQCIPKHFMCDHDRDCADGSDESPECEYPTCGPNEFRCANGRCLSSRQWECDGE
NDCHDQSDEAPKNPHCTSPEHKCNASSQFLCSSGRCVAEALLCNGQDDCGDGSDERGCHI
NECLSHKLSGCSQDCEDLKIGFKCRCRPGFRLKDDGRTCADMDECSTTFPCSQRCINTHG
SYKCLCVEGYAPRGGDPHSCKAVTDEEPFLIFANRYYLRKLNLDGSNYTLLKQGLNNAVA
LDFDYREQMIYWTDVTTQGSMIRRMHLNGSNVQVLHRTGLSNPDGLAVDWVGGNLYWCDK
GRDTIEVSKLNGAYRTVLVSSGLREPRALVVDVQNGYLYWTDWGDHSLIGRIGMDGSSRS
VIVDTKITWPNGLTLDYVTERIYWADAREDYIEFASLDGSNRHVVLSQDIPHIFALTLFE
DYVYWTDWETKSINRAHKTTGTNKTLLISTLHRPMDLHVFHALRQPDAVPNHPCKVNNGG
CSNLCLLSPGGGHKCACPTNFYLGGDGRNCVSNCTASQFVCKNDKCIPFWWKCDTEDDCG
DHSDEPPDCPEFKCRPGQFQCSTGICTNPAFICDGDNDCQDNSDEANCDIHVCLPSQFKC
TNTNRCIPGIFRCNGQDNCGDGEDERDCPEVTCAPNQFQCSITKRCIPRVWVCDRDNDCV
DGSDEPANCTQMTCGVDEFRCKDSGRCIPARWKCDGEDDCGDGSDEPKEECDERTCEPYQ
FRCKNNRCVPGRWQCDYDNDCGDNSDEESCTPRPCSESEFSCANGRCIAGRWKCDGDHDC
ADGSDEKDCTPRCDMDQFQCKSGHCIPLRWRCDADADCMDGSDEEACGTGVRTCPLDEFQ
CNNTLCKPLAWKCDGEDDCGDNSDENPEECARFVCPPNRPFRCKNDRVCLWIGRQCDGTD
NCGDGTDEEDCEPPTAQTSHCKDKKEFLCRNQRCLSSSLRCNMFDDCGDGSDEEDCSMDP
KLTSCATNASICGDEARCVRTEKAAYCACRTGFHTVPGQPGCQDINECLRFGTCSQLCNN
TKGGHLCSCARNFMKTHNTCKAEGSEYQVLYIADDNEIRSLFPSHPHSAYEQAFQGDESV
RIDAMDVHVKAGRVYWTNWHTGTISYRSLPPAAPPTTSNRHRRQIDRGVTHLNISGLKMP
RGIAIDWVAGNVYWTDSGRDVIEVAQMKGENRKTLISGMIDEPHAIVVDPLRGTMYWSDW
GNHPKIETAAMDGTLRETLVQDNIQWPTGLAVDYHNERLYWADAKLSVIGSIRLNGTDPI
VAADSKRGLSHPFSIDVFEDYIYGVTYINNRVFKIHKFGHSPLINLTGGLSHASDVVLYH
QHKQPEVTNPCDRKKCEWLCLLSPSGPVCTCPNGKRLDNGTCVAVPSPTPPPDAPRPGTC
NLQCFNGGSCFLNARRQPKCRCQPRYTGDKCELDQCWEHCRNGGTCAASPSGMPTCRCPT
GFTGPKCTQQVCAGYCANNSTCTVNQGNQPQCRCLPGFLGDRCQYRQCSDYCENFGTCQM
AADGSRQCRCTAYFEGPRCEVNKCSRCLDGACVVNKQSGDVTCNCSDGRVAPSCLTCIGH
CSNGGSCTMNSKMMPECQCPPHMAGPRCEEQVVGQQQPGHVASILIPLLLLLLMLLVAGV
VFWYKRRVRGAKGFQHQRMTNGAMNVEIGNPTYKMYEGGEPDDVGGLLDADFALDPDKPT
NFTNPVYATLYMGGHGSRHSLASTDEKRELLGRGPEDEIGDPLA
Download sequence
Identical sequences E1BGJ0
ENSBTAP00000017556 ENSBTAP00000017556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]