SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000017563 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000017563
Domain Number 1 Region: 27-151
Classification Level Classification E-value
Superfamily TIMP-like 4.79e-56
Family The laminin-binding domain of agrin 0.000000476
Further Details:      
 
Domain Number 2 Region: 1339-1545
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.18e-44
Family Laminin G-like module 0.00032
Further Details:      
 
Domain Number 3 Region: 1824-2030
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.27e-38
Family Laminin G-like module 0.000000276
Further Details:      
 
Domain Number 4 Region: 1597-1794
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.86e-34
Family Laminin G-like module 0.00051
Further Details:      
 
Domain Number 5 Region: 459-526
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 5.41e-17
Family Ovomucoid domain III-like 0.0088
Further Details:      
 
Domain Number 6 Region: 163-233
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000568
Family Ovomucoid domain III-like 0.004
Further Details:      
 
Domain Number 7 Region: 542-591
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000735
Family Ovomucoid domain III-like 0.0097
Further Details:      
 
Domain Number 8 Region: 892-961
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000222
Family Ovomucoid domain III-like 0.0073
Further Details:      
 
Domain Number 9 Region: 390-453
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000137
Family Ovomucoid domain III-like 0.0044
Further Details:      
 
Domain Number 10 Region: 1136-1212
Classification Level Classification E-value
Superfamily SEA domain 0.00000000000144
Family SEA domain 0.0028
Further Details:      
 
Domain Number 11 Region: 239-309
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000222
Family Ovomucoid domain III-like 0.0058
Further Details:      
 
Domain Number 12 Region: 691-741
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000222
Family Ovomucoid domain III-like 0.0017
Further Details:      
 
Domain Number 13 Region: 609-656
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000499
Family Ovomucoid domain III-like 0.01
Further Details:      
 
Domain Number 14 Region: 1537-1614,1793-1841
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000157
Family Growth factor receptor domain 0.0093
Further Details:      
 
Domain Number 15 Region: 331-381
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000652
Family Ovomucoid domain III-like 0.0081
Further Details:      
 
Domain Number 16 Region: 784-827
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000165
Family Laminin-type module 0.0045
Further Details:      
 
Domain Number 17 Region: 838-875
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000248
Family Laminin-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000017563   Gene: ENSBTAG00000013191   Transcript: ENSBTAT00000017563
Sequence length 2032
Comment pep:known_by_projection chromosome:UMD3.1:16:52674207:52712338:-1 gene:ENSBTAG00000013191 transcript:ENSBTAT00000017563 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQPLLLLLVVAVRALPSADGTCPERALERREEEANVVLTGTVEEILNVDPVQHTYSCKVR
VWRYLKGKDVVAQESLLDGGNKVVIGGFGDPLICDNQVSTGDTRIFFVNPAPPYLWPAHK
NELMLNSSLMRITLRNLEEVEHCVEDKPGTHFTPVPPTPPDACRGMLCGFGAVCEPSADE
PGRASCVCKKSSCPSVVAPVCGSDASTYSNECELQRAQCSQQRRIRLLRRGPCGTRDPCS
NVTCSFGSTCVPSADGLTATCLCPATCLGAPEGPVCGSDGSDYPSECQLLRHACAHQENI
FKKFDGPCDPCQGFLSDLSRTCRVNPRTRRPEMLLRPESCPPRGTPVCGDDGVTYDNDCV
MGRTGAAQGILLQKVRSGQCQPRDQCPEPCRFNAVCLSRRGRPRCSCDRVVCDGAYRPVC
AHDGHTYDNDCWRQQAECQQQRSIPMKHQGPCDQSPSPCRGVQCPFGAMCAVKNGEAECA
CPKACSGVYDPVCGSDGITYGSACELEATACALGREIRVARRGPCDRCGQCRFGALCEAE
TGRCVCPSECVASAQPVCGSDGRTYASECELHVHACTHQISLHVASAGPCQTCGDTVCAF
GAVCSAGQCVCPRCERPPPGPVCGSDGVTYGSSCELREAACQQQTQIEEAWAGPCEQAEC
GSGGSGSGEDGECEPELCRQRGGIWDEDSEDGPCVCGFSCQGVLRSPVCGSDGVTYRTEC
ELKKARCESQPELYVVAQGACRGPTLAPLPPAIPLHCAQTPYGCCQDNITVAQGVGLAGC
PSSCQCNPHGSYGGTCDPVTGQCSCRPGVGGLKCDRCEPGFWNFRGIVTDGRSGCTPCSC
DPRGAVRDDCEQMTGLCSCKPGVAGPKCGQCPDGRALGPAGCETDSSPPKTCAEMLCEFG
ASCVEEAGSAHCVCPTPTCPGADATKVCGSDGVTYGNECQLRTIACRQGLEISIQSFGPC
QEGITSGPRVTSASVAPSALDLNKAPLPPPSALPLAPSSTRHSQPTSRASSQPWTMASIP
RTTARPVLTMPPVAPSPAASLVTSAFGESGSADGSGDEELSGDLEASGAGSGGLESPERD
SAGTPGLPMERASCYNSPMGCCSDGKTPSLDAEGSNCPATKVFQGVLELEGVEGQELFYT
PEMADPKSELFGETARSIESALDDLFRNSDVKKDFRSVRLRDLGPGSSVRAIVEVHFDPT
TAFRASDVGRALLRQLQASRRRSLGVRRPLQEHVRFMDFDWFPAFFTGATPAAATARATT
VARLPPSAATPRAHFPSHTSRPVSRTTPPATTRQPPTTAPSRVPGRRPLPPGTQQPRRPC
DSQPCLHGGTCQDQGSGADFTCSCPAGTGGAVCEKALHPSVPAFGGHSFLAFPTLRAYHT
LRLALEFRALEPQGLLLYNGNARGKDFLGLVLLGGRVQFRFDTGSGPAVLTSSVPVQPGR
WHHLELSRHWRQGTLSVDGETPVLGQSPSGTDGLNLDTDLFVGGVPEDQASTVLERTSVS
IGLRGCIRLLDVNNQRLELSSWPESATRSSGVGKCGDHPCLPSPCLGGAPCQALEAGRFH
CQCPPGRFGPTCADEKDPCQPNPCHGAAPCRVLPQGEAKCECPHGREGSLCQTVSEPEDN
QPFLADFSSFSYLELKGLHTFERDLGEKMALEVVFLARSPSGLLLYNGQKTDGKGDFVSL
ALHNGLLEFRYDLGKGAAVIRSKEPVALGAWTRVSLERNGRKGAMRVGDGPRVLGESPVP
HTVLNLKEPLFVGGAPDFSKLARAAAVSSGFDGAIQLVSLNGRQLLTRENVVRAVDVSSF
ADHPCTQAEGQPCLHGASCLPREASYECLCPAGFSGLHCEKGLIEKSAGDLDALAFDGRT
YIEYLNAVTESEKALQSNHFELSLRTEATQGLVLWSGKATERADYIALAIVDGRLQLAYD
LGSQPVVLRSTVPVNTNRWLRVRAHRKQREGSLQVGNEAPVTGSSPLGATQLDTDGALWL
GGLEKLPTGQALPKAYGTGFVGCLRDVVVGQRPVHLLEDAITKPELRPCPAL
Download sequence
Identical sequences F1MSI2
ENSBTAP00000017563 9913.ENSBTAP00000017563 ENSBTAP00000017563

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]