SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000017571 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000017571
Domain Number 1 Region: 140-456
Classification Level Classification E-value
Superfamily L domain-like 1.36e-55
Family Ngr ectodomain-like 0.0033
Further Details:      
 
Domain Number 2 Region: 21-197
Classification Level Classification E-value
Superfamily L domain-like 2.93e-26
Family Ngr ectodomain-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000017571   Gene: ENSBTAG00000013203   Transcript: ENSBTAT00000017571
Sequence length 583
Comment pep:known_by_projection chromosome:UMD3.1:1:73740503:73776574:1 gene:ENSBTAG00000013203 transcript:ENSBTAT00000017571 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRSALLCAALWLLRAQPFPCPPTCRCAFRDAAQCSRGTVAGIAALGLPTNLTHILLFQM
GRGTLQNNSFSDMTVLQRLLLSDSHVSAIAPGTFNDPIKLKTLRLSRNKITHLPSALLDN
LVLLEQLFLDGNELKSLDQNLFQKLVHLQELFLNQNQLAFLPASLFTHLGNLKLLDLSGN
NLTHLPEGLFGVQVKLQKLLLHSNRLASLESGLLDSLRALTELQLHTNHLRSIVPGAFDR
LRSLSSLTLSENRLEFLPSALFLHSHNLTFLTLSENPLEELPKVLFGEIGGLRELRLKST
QLRTLPAAAFRNLTGLRVLEVSLSPRLSALPEDAFRGLGELQVLALSSTGLASLPAGLLR
GLCRLRHVSLRSNRLRALPSALFRNLSSLEEVQLDHNQLETLPGDAFEALPRLAGVLLGH
NPWRCDCGLGPFLAWLRRHAGLVGRAEPPRCHGPGPHAGRLLWTLQAGDLGCPRPESWTR
LVAEGQSQDHNLFWGLYFLLLAAQALITGIIVFAMIKLCRLFRKLITELWFEAGMPHGCP
RTSGAAVARAPPCHRADTAPGGDSRQAALKYAEDPGAALMLQP
Download sequence
Identical sequences E1BG29
ENSBTAP00000017571 ENSBTAP00000017571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]