SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000017599 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000017599
Domain Number 1 Region: 14-112
Classification Level Classification E-value
Superfamily DNA clamp 0.000000785
Family DNA polymerase processivity factor 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000017599   Gene: ENSBTAG00000013226   Transcript: ENSBTAT00000017599
Sequence length 280
Comment pep:known_by_projection chromosome:UMD3.1:4:75146925:75159359:1 gene:ENSBTAG00000013226 transcript:ENSBTAT00000017599 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKFRAKIVDTACLNHFTRVSNMIAKLAKTCTLRISPDKLNFILSDRVANGGVSMWCELEQ
ENFFSEFQMEGVSAENNEIYLELTSENLSRALKTAQNARALKIKLTNKHFPCLTVSIELL
SVSSSSRVVTHDIPVKVIPRKLWKDLQEPTVPDADVSIYLPVLKTMKSVVEKMKNISNHL
IIEANLNGELNLKIETELVCVTTHFKDLGNPPLASENASQDRNLEQMAEVHIDIRKLLQF
LAGQQVNPTKATCNIVKNKIVHFDLLHEDVSLQYFIPALS
Download sequence
Identical sequences E1BG06 L8IVH7
ENSBTAP00000017599 XP_005205646.1.76553 XP_006075287.1.26621 XP_010827310.1.44457 XP_019814453.1.53367 ENSBTAP00000017599 9913.ENSBTAP00000017599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]