SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000017619 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000017619
Domain Number 1 Region: 42-210
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.74e-36
Family G proteins 0.0000133
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000017619   Gene: ENSBTAG00000012954   Transcript: ENSBTAT00000017619
Sequence length 234
Comment pep:known_by_projection chromosome:UMD3.1:X:92016870:92017574:1 gene:ENSBTAG00000012954 transcript:ENSBTAT00000017619 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQPTKPDMFDLGLGTWSPRSREQSHRAWGSPSKGVGKKLPEYKAVVVGASGVGKSALTI
QLNNQCFVEDHDPTIQDSYWKEMALDHGGCILNVLDTAGQATHQALRDQCVAIGDGVLGV
FALDDPSSLAQLQQMRATWGPHHTQPLVLVGNKCDLVTTTGDARAAAAALAKSWGAPFVE
TSAKTRQGVVEAFSLLIQEIQRVREAMAKEATTGPGGDKGRHQKAMCHCGCSVA
Download sequence
Identical sequences E1BEP6
XP_002700122.2.76553 XP_006045761.1.26621 XP_006045762.1.26621 XP_006045763.1.26621 XP_006045764.1.26621 XP_006045765.1.26621 XP_006045766.1.26621 XP_010798823.1.59421 XP_010798825.1.59421 XP_010820234.1.76553 XP_010820236.1.76553 XP_015317175.1.76553 XP_015325944.1.59421 XP_591307.3.59421 ENSBTAP00000017619 ENSBTAP00000017619 9913.ENSBTAP00000017619

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]