SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000017746 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000017746
Domain Number 1 Region: 1862-2106
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.29e-53
Family Ankyrin repeat 0.000000056
Further Details:      
 
Domain Number 2 Region: 440-571
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000105
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 3 Region: 1171-1313
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000173
Family Growth factor receptor domain 0.0078
Further Details:      
 
Domain Number 4 Region: 858-988
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000188
Family Growth factor receptor domain 0.009
Further Details:      
 
Domain Number 5 Region: 630-758
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000408
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 6 Region: 289-457
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000104
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 7 Region: 755-796
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000051
Family EGF-type module 0.0041
Further Details:      
 
Domain Number 8 Region: 792-830
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000115
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 9 Region: 142-187
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000145
Family EGF-type module 0.01
Further Details:      
 
Domain Number 10 Region: 604-642
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000448
Family EGF-type module 0.0097
Further Details:      
 
Domain Number 11 Region: 981-1102
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000502
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 12 Region: 178-218
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000803
Family EGF-type module 0.0034
Further Details:      
 
Domain Number 13 Region: 258-301
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000041
Family EGF-type module 0.019
Further Details:      
 
Domain Number 14 Region: 1146-1182
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000541
Family EGF-type module 0.012
Further Details:      
 
Domain Number 15 Region: 220-262
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000293
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 16 Region: 833-869
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000332
Family EGF-type module 0.014
Further Details:      
 
Domain Number 17 Region: 564-606
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000456
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 18 Region: 106-141
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000949
Family EGF-type module 0.02
Further Details:      
 
Domain Number 19 Region: 1490-1523
Classification Level Classification E-value
Superfamily Notch domain 0.000000109
Family Notch domain 0.0045
Further Details:      
 
Domain Number 20 Region: 1530-1562
Classification Level Classification E-value
Superfamily Notch domain 0.000000196
Family Notch domain 0.0045
Further Details:      
 
Domain Number 21 Region: 1309-1353
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000261
Family EGF-type module 0.014
Further Details:      
 
Domain Number 22 Region: 62-101
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000779
Family EGF-type module 0.011
Further Details:      
 
Domain Number 23 Region: 1111-1150
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000162
Family EGF-type module 0.02
Further Details:      
 
Domain Number 24 Region: 1449-1481
Classification Level Classification E-value
Superfamily Notch domain 0.00000235
Family Notch domain 0.00028
Further Details:      
 
Domain Number 25 Region: 1392-1429
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000024
Family EGF-type module 0.026
Further Details:      
 
Domain Number 26 Region: 1346-1386
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000232
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000017746   Gene: ENSBTAG00000022799   Transcript: ENSBTAT00000017746
Sequence length 2534
Comment pep:known chromosome:UMD3.1:11:103986874:104030692:-1 gene:ENSBTAG00000022799 transcript:ENSBTAT00000017746 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPLLAPLLCLALLPALAARGLRCSQPGETCLNGGKCEVFPNGTEACICGGAFAGQQCQA
PNPCLSAPCKNGGTCHTTEREGLVDYVCGCRLGFSGPLCLTPRDHACLASPCLNGGTCDL
LTLTEYKCLCTPGWSGKTCQQADPCASNPCANGGQCLPFEASYICHCPPGFHGPTCRQDV
NECSQSPGLCHHGGTCLNEVGSYRCVCRPTHTGPHCELPYVPCSPSPCQNGGTCRPTGDT
THECACLPGFTGQNCEENIDDCPGNSCKNGGACVDGVNTYNCRCPPEWTGQYCTEDVDEC
QLMPNACQNGGTCHNTHGGYNCVCVNGWTGEDCSENIDDCASASCFQGATCHDRVASFYC
ECPHGRTGLLCHLNDACISNPCNEGSNCDTNPVNGKAICTCPSGYTGPACSQDVDECSLG
ANPCEHAGKCINTLGSFECQCLQGYTGPRCEIDVNECVSNPCQNDATCLDQIGEFQCICM
PGYEGLHCEVNTDECASSPCLQNGRCLDKINEFVCECPTGFTGHLCQYDVDECASTPCKN
GAKCLDGPNTYTCVCTEGYTGPHCEVDIDECDPDPCHYGSCKDGVATFTCLCQPGYTGHH
CESNINECHSQPCRHGGTCQDRDNAYLCFCLKGTTGPNCEINLDDCASNPCDSGTCLDKI
DGYECACEPGYTGSMCNINIDECADSPCHNGGTCEDGINGFTCRCPEGYHDPTCLSEVNE
CSSNPCIHGACRDSLNGYKCDCDPGWSGANCDVNNDECESNPCINGGTCKDMTSGYVCAC
REGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCLLPYTGATCEVVLAPCAPGPCR
NGGECRESEDYESFSCACPAGWQGQTCEIDINECVKSPCRAGASCQNTNGSYRCHCQAGY
TGRNCETDIDDCRPNPCHNGGSCTDGINTAFCDCLPGFQGAFCEEDINECASSPCRNGAN
CTDCVDSYTCTCPTGFSGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPPGFTGSYCQ
HDVNECDSRPCLHGGTCHDSYGTYTCTCPQGYTGLNCQTLVRWCDSSPCKNDGRCWQTNA
LYRCECHSGWTGLYCDVPSVSCEVAARQQGVNVTHLCRNGGLCMNAGNTHRCHCQAGYTG
SYCEEQVDECSPSPCQNGATCTDYPGGYSCECVAGYHGVNCSEEVNECLSQPCRNGGTCI
DLTNTYKCSCPRGTQGVHCEINVDDCNPPIDPVSRGPKCFNNGTCVDQVGGYSCSCPPGF
VGERCEGDVNECLSNPCDARGTQNCVQHVNAFHCECRAGHTGRRCESVINGCKDRPCKNG
GSCAVASNTARGFICKCPAGFEGATCENDARSCGSLRCLNGGTCIAGPRSPTCLCLGPFT
GPECQFPASSPCVGGNPCYNQGVCEPTAESPFYRCRCPAKFNGLLCHILDYSFGGGVGLD
IPPPQIEETCELPGCREEAGNKVCSLQCNSHACGWDGGDCSLDFDDPWQNCTQSLQCWKY
FSNGRCDSQCNSAGCLFDGFDCQRAEGQCNPLYDQYCKDHFRDGHCDQGCNSAECEWDGL
DCAEHVPERLAAGTLVLVVLMPPEQLRNRSLHFLRELSRLLHTNVVFKRDASGQQMIFPY
YGQEPHCRQGSAPRSVGVSTTHALLVLDKASPQGHCAPPGLFLSIVYLEIDNRQCVQSSS
QCFQSATDVAAFLGALASLGSLNIPYKIEAVQSETVEPPPPPPLHFMYVAVVAFVLLFFV
GCGVLLSRKRRRQHGQLWFPEGFKVSEASKKKRREPLGEDSVGLKPLKNSSDGALMDDNQ
NEWGDEGLEAKKFRFEEPVVLPDLDDQTDHRQWTQQHLDAADLRVSAMAPTPPQGEADAD
CMDVNVRGPDGFTPLMIASCSGGGLETGNSEEEEDAPAVISDFIYQGASLHNQTDRTGET
ALHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAAVSADAQGVFQILIRNRATDLDA
RMHDGTTPLILAARLAVEGMLEDLINSHADVNAVDDLGKSALHWAAAVNNVEAAVVLLKN
GANKDMQNNKEETPLFLAAREGSYETAKVLLDHFANRDITDHMDRLPRDIAQERMHHDIV
RLLDEYSLVRSPPLHGATLGGTPTLSPPLCSPNGYLGNLKPPMQGKKARKPSTKGLACGG
KEPKDLKARRKKSQDGKGCLLDSGSVMSPVDSLESPHGYLSDVASPPLLPSPFQPSPSVP
LNHLPGMPETHLGVSHLSVAAKPEMAVLSGGSRLAFEAGPPRLSHLPVASSTSTILGSGG
SGGSGAVNFTVGGAAGLNGQCEWLSRLQNGLVPNQYNPLRGGVTPGTLSTQAAGLQHGTV
GPLHAPALSQVMTYQALPSTRLASQPHLVQPQQNLQMQPPSMPPQPNLQPHLGVSSAASG
HLGRSFLGGELSQADMQPLGPGNLAAHTVLPQDGQVLPTSLPSTLAPPTMAPPMTTAQFL
TPPSQHSYSSSPVDNTPSHQLQVPEHPFLTPSPESPDQWSSSSPHSNISDWSEGISSPPT
SVPSQIAHVPEAFK
Download sequence
Identical sequences F1MSM3
ENSBTAP00000017746 ENSBTAP00000017746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]