SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000017783 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000017783
Domain Number 1 Region: 1010-1213
Classification Level Classification E-value
Superfamily vWA-like 1.78e-58
Family Integrin A (or I) domain 0.0001
Further Details:      
 
Domain Number 2 Region: 145-338
Classification Level Classification E-value
Superfamily vWA-like 5.34e-58
Family Integrin A (or I) domain 0.0001
Further Details:      
 
Domain Number 3 Region: 1231-1435
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.31e-34
Family Laminin G-like module 0.029
Further Details:      
 
Domain Number 4 Region: 537-703
Classification Level Classification E-value
Superfamily Fibronectin type III 1.06e-22
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 5 Region: 32-123,345-431
Classification Level Classification E-value
Superfamily Fibronectin type III 1.68e-18
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 6 Region: 741-911
Classification Level Classification E-value
Superfamily Fibronectin type III 6.33e-18
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 7 Region: 448-533
Classification Level Classification E-value
Superfamily Fibronectin type III 5.87e-16
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 8 Region: 924-1007
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000163
Family Fibronectin type III 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000017783   Gene: ENSBTAG00000013369   Transcript: ENSBTAT00000017783
Sequence length 1800
Comment pep:known_by_projection chromosome:UMD3.1:14:83892853:84109620:1 gene:ENSBTAG00000013369 transcript:ENSBTAT00000017783 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKIFHCKMQYWVFPAFFVITYLCTIVQGQVAPPTRLRYNVLSHDSIQISWKAPRGKFGGY
KLLVTPASGGKTNQLNLQNTATKAIIQGLMPDQNYTVQIIAYNKDKESKPAQGQFRIKDL
EKRKEPKPRVKVVDKGGENKPSVPEEEVKFFCQTPAIADIVILVDGSWSIGRFNFRLVRS
FLENLVTAFDVGSEKTRIGLAQYSGDPRIEWHLNAFNTKDEVIDAVRNLPYKGGNTLTGL
ALNYIFENSFKPEAGARTGVSKIGILITDGKSQDDIIPPSRNLRESGVELFAIGVKNADE
KELQEIASEPDSTHVYNVAEFDLMHTVVESLTRTVCSRVEEQDREIKASALATVGPPTEL
MTSEVTARSFMVNWTHAPGKVEKYRIVYYPTRGGKPEEVVVDGRVSSTVLRNLMSLTEYQ
IAVFAIYAHTASEGLRGTETTLSLPIASDLELYDVTENSLRARWNPVPGASGYLILYAPL
TEGLAGDEKEVKIGETHTDIELSGLLPNTEYTVTVYAMFGEEASDPVTGQESTLPLSPPR
NLRISNIGSNSARLAWDATSTKINGYRIIYNNADGTEINEVEVDPVTTFPLKGLTPLTEY
TVTILSIYDEGQSEPLTGVFTTEEVPAQQYLEIDEVTPDSFRVSWHPLSADEGQHKLMWI
PVYGGSTEEVVLQEDQDSYVIEGLEPGTEYEVSLLAVLDDGSESEVVTAVGTTLDSFWTE
PPTTEEAPTRPVTSVFRTGIRNLVVDAETTSSLRVAWDISDSSVQQFRVTYLTAQGDPAE
EVLGTIMVPGSQNTLLLKNLLSETEYKVTVTPIYDDGEGVSVSAPGKTLPPSGPQNLRVS
EEWYNRLRIAWDPPSSPVKGYRIVYKPVSVAGPTLETFVGANINTILITNLLSGMDYNVK
IFASQASGFSDALTGVVKTLFLGVTDLQADEVQTTSLCARWQVQRHATTYRVVLESRQDT
QKQESTLGGGTNRHCFYGLQPDSEYKISVYTKLQEMEGPSVSVTAKTQSLPTQPPTFPPT
IPPAKEVCRAAKADLVFMVDGSWSIGDENFNKIINFLYSTVGALDKIGADGTQVAMVQFT
DDPRTEFKLNSYKTKETLLDAIKHISYKGGNTKTGKAIKHVRDSLFTAESGTRRGIPRVI
VVITDGRSQDDVNKISREMQSDGYSIFAVGVADADYSELVSIGSKPSARHVFFVDDFDAF
KKIEDELITFVCETASATCPLVHKDGIDLAGFKMMEMFGLVEKEFSSVEGVSMEPGTFNV
YPCYQLHKDALVSQPTKYLHPEGLPSDYTISILFRILPDTPEEPFALWEILNKNSDPLVG
VILDNGGKTLTYFNYDYSGDFQTVTFEGPEIRKIFYGSFHKLHIVVSKTLAKVVIDCKQV
GEKAINASSNITLDGVEVLGRMVRSRGPNGNSAPFQLQMFDIVCSTSWANKDKCCELPAL
RDEEACPELPHACSCSEINKAALGPAGPPGGPGLRGPKGQRGDPGLKGPDGPRGETGPPG
PQGPPGPQGPSGLSIQGMPGMPGEKGEKGEIGLPGPQGVPGSVGSPGRDGSPGQRGFPGK
DGSSGPPGPPGPIGIPGAPGVPGVTGSMGPQGALGPPGVPGAKGERGERGDLQSQAMVRA
VARQVCEQLIQSHMSRYTAILNQIPSHSSSVRTIQGPPGEPGRPGSPGTPGEQGPPGAPG
FPGNAGVPGSPGERELGLTGVKGEKGNPGIGTQGPRGPPGPAGPSGESRPGSPGPPGSPG
PRGPPGHLGVPGPQGPSGQPGYCDPSSCSAYGVGAPHPDQPEFTPVQDELEAMELWGSGI
Download sequence
Identical sequences E1BA17
ENSBTAP00000017783 ENSBTAP00000017783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]