SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000017857 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000017857
Domain Number 1 Region: 317-471
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.27e-34
Family SPRY domain 0.0012
Further Details:      
 
Domain Number 2 Region: 155-266
Classification Level Classification E-value
Superfamily Fibronectin type III 1.77e-16
Family Fibronectin type III 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000017857   Gene: ENSBTAG00000013420   Transcript: ENSBTAT00000017857
Sequence length 497
Comment pep:known_by_projection chromosome:UMD3.1:8:96964125:97006477:1 gene:ENSBTAG00000013420 transcript:ENSBTAT00000017857 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSQREALQRIISTLANKNDEIQNFIDTLNQTLKGVQENSSNILSELDEEFDSLYSILDE
VKESMINSIKQEQARKSQELQSQLSQCNNALENSEELLEFATRSLDIKEPEEFSKAARQI
KDRVTMASAFRLSLKPKVSDNMTHLMVDFSQERQILQTLKFLPVPKAPEIDPVECLVADN
SVTVAWRMPEEDNKIDHFILEYRKTNFDGLPRVKDERCWEIVDNIKGTEYTLSGLKFDSK
YMNFRVRACNKAVAGEYSDPVTLETKALNFNLDNSSSHLNLRVEDTCVEWDPTGGKGQDS
KSKGKENKGRSGTPSPKRTSVGSRPPAVRGSRDRFTGESYTVLGDTAIESGQHYWEVKAQ
KDCKSYSVGVAYKTLGKFDQLGKTNTSWCIHVNNWLQNTFAAKHNNKVKALDVAVPERIG
VFCDFDGGQLSFYDANSKQLLYSFKAKFTQPVLPGFMVWCGGLSLSTGMQVPSAVRTLQK
NENGMTGSTSSLNNITQ
Download sequence
Identical sequences F1MAU6
ENSBTAP00000017857 ENSBTAP00000017857 NP_001179189.1.59421 NP_001179189.1.76553 XP_005909355.1.15283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]