SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000017907 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000017907
Domain Number 1 Region: 17-234
Classification Level Classification E-value
Superfamily L domain-like 3.06e-32
Family Internalin LRR domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000017907   Gene: ENSBTAG00000013464   Transcript: ENSBTAT00000017907
Sequence length 858
Comment pep:known_by_projection chromosome:UMD3.1:1:46431094:46452391:1 gene:ENSBTAG00000013464 transcript:ENSBTAT00000017907 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAACAAAALPPGEGSVVNWSGQGLQKLSPNLPCEADIHTLILDKNQIIKLENLEKCKRL
VQLSVANNRLVRMMGVAKLTQLRVLNLPHNSIGYVEGLKELVHLEWLNLAGNNLKAMEQI
NTCTSLQHLDLSDNNIPQIGDLSKLVSLKTLLLHGNIITSLRMAPAYLPRCLAILSLAEN
EIRDLNEVSFLASLTELEQLSIMNNPCVMATPSIPGFDYRPYIVSWCLSLRVLDGYMISQ
KESLKAEWLYSQGKGRAYRPGQHIQLVQYLATVCPLTSTLGLQTAEDAKLEKILSKQRFH
QRQLMNQSHNEESSPVESRASLVPEHSSPIQDGQVVPESEPVIQVNSWVGISSHDDQSHA
VKNNFPTPVHTARYSRNDLHLEDIQTDEDKLNCSLLSSESTFMPVASGLSPVSPTVELRL
QGINLSLEDDAAADESVKGPENQDLSNKEEEKALGAANENSVQMTKSAVGTEINEKDGLL
PCPEPTVTSAGLKDHTHSLTSFPESVGRNVFHTQPDSEEARSQTASEKVPCRLLTQKSVP
LGQDKVALQKLNEAATKLQACWRGFYARNYNPQARDVRYEIRLRRMQEHIVCLTGEIRRL
KKERDEERIQKFVQEEAVRFLWNQVRSLQAWQQTVDQHLSSCHIDVPPISSTLVPSKPPL
FTQSQQPSSDQNSDWFIAPDEAPQEKSLPEFPDSGFHSSLTEQVHSLQDSLDFEKSSTEG
SESSTMGNSIDTVKYGKESDVGDVSEEHGEWGKEGSNNEQDNSLLEQYLTSVQQLDDADE
RRHFDEGMGDSKLHLPRSPERLDVLSDSASIDVAQGVSPALQYEVSQTPENCELNAEVQG
QQSERDSTFQVLHVGIIV
Download sequence
Identical sequences E1BBI2
NP_001179353.1.59421 NP_001179353.1.76553 XP_015326359.1.76553 ENSBTAP00000017907 ENSBTAP00000017907 9913.ENSBTAP00000017907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]