SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000017949 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000017949
Domain Number 1 Region: 2671-2959
Classification Level Classification E-value
Superfamily BEACH domain 2.49e-126
Family BEACH domain 0.0000000151
Further Details:      
 
Domain Number 2 Region: 3030-3229,3392-3424
Classification Level Classification E-value
Superfamily WD40 repeat-like 7.33e-32
Family WD40-repeat 0.001
Further Details:      
 
Domain Number 3 Region: 2517-2639
Classification Level Classification E-value
Superfamily PH domain-like 1.05e-22
Family PreBEACH PH-like domain 0.017
Further Details:      
 
Domain Number 4 Region: 3432-3501
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 7.67e-20
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0015
Further Details:      
 
Domain Number 5 Region: 1090-1285
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000188
Family Vibrio cholerae sialidase, N-terminal and insertion domains 0.074
Further Details:      
 
Domain Number 6 Region: 468-512,578-656,850-910
Classification Level Classification E-value
Superfamily ARM repeat 0.0000125
Family HspBP1 domain 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000017949   Gene: ENSBTAG00000013495   Transcript: ENSBTAT00000017949
Sequence length 3509
Comment pep:known_by_projection chromosome:UMD3.1:6:101289985:101484302:-1 gene:ENSBTAG00000013495 transcript:ENSBTAT00000017949 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNMVKRIMGRPRQEECSPQDNALGLMHLRRLFTELCHPPRHMTQKEQEEKLYMMLPVFNR
VFGNAPPNTMTEKFSDLLQFTTQVSRLMVTEIRRRASNKSTEAASRAIVQFLEINQSEEA
SRGWMLLTTINLLASSGQKTVDCMTTMSVPSTLVKCLYLFDLPHVLRSGGAQNELPLAER
RGLLQKVFVQILVKLCSFVSPAEELAQKDDLQLLFSAITSWCPPYNLPWRKSAGEVLMTI
SRHGLSVNVVKYIHEKECLSTCVQNMQQSDDLSPLEIVEMFAGLSCFLKDSSDVSQTLLD
DFRIWQGYNFLCDLLLRLEQAKEAESKDALKDLVNLITSLTTYGVNELKPAGITTGAPFL
LPGFAVPQPAGKGHSVRNIQAFAVLQNAFLKAKTNFLAHIILDAITNIYMADNANYFILE
SQHTLSQFAEKISKLPEVQNKYFEMLEFVVFSLNYIPCKELISVSILLKSSSSYHCSIIA
MKTLLKFTRHDYIFKDVFREVGLLEVMVNLLHKYAALLKDPTQALNEQGDSRNNSSFEDQ
KHLALLVMETLTVLLQGSNTNAGIFREFGGARCAHNIVRYPQCRQHALMMIQQLVLSPNG
DDDMGTLLGLMHSAPPTELQLKTDILRALLSVLRESHRSRTVFRKVGGFVYVTSLLVAME
RSLSAPPKNGWEKVSQGHVFELLHTVFCTLTAAMRYEPANSHFFKTEIQYEKLADAVRFL
GCFSDLRKISPMNVFPSNTQPFQRLLEEDVISMDSVSPTLRHCSKLFIYLYRVATDSFDS
RAEQIPPCLTSESSLPSPWGTPALSRKRHAYHSVSTPPVYPPKNVADLKPHVATSSLSSS
DAVIIHPGAMLAMLDLLASVGSVTQPEHALDLQLAVANILQSLVHTERNQQVMCEAGLHA
RLLQRCSAALADEDHSLHPPLQRMFERLASQALEPMVLREFLRLASPLNCGAWDKKLLKQ
YRVHKPSSLSFEPEMRSSMITSMEGLGSDNVFSLHEDNHYRISKSLVKSAEGSTVPLTRV
KCLVSMTTPHDIRLHGSSVTPAFVEFDTSLEGFGCLFLPSLAPHNAPTNNAVTTGLIDGA
VVSGIGSGERFFPPPSGLSYSSWFCIEHFSSPPSNHPVRLLTVVRRANSSEHHYVCLAIV
LSAKDRSLIVSTKEELLQNYVDDFSEESSFYEILPCCARFRCGELIVEGQWHHLVLVMSK
GMLKNSTATLYIDGQLVSTVKLHYVHSTPGGSGSANPPVVSTVYAYIGTPPAQRQIASLV
WRLGPTHFLEEVLPPSNVTTIYELGPNYVGSFQAVCMPCKDAKSEGVVPSPVSLVPEEKV
SFGLYALSVSALTVARIRKVYNKLDSKAIAKQLGISSHENATPVKLIHNSAGHLNGPART
IGASLIGYLGVRTFVPKPVATTLQYVGGAAAILGLVAMASDVEGLYAAVKALVCVVKSNP
LASKEMERIRGYQLLAMLFKKKRSLLNSHILHLTFSLVGTVDSGHETSIIPNSTAFQDLL
CDFEVWLHAPYELHLSLFEHFIELLTESSEASKNAKLMREFQLIPKLLLTLRDMSLSQPT
IAAISNVLSFLLQGFPNSNDLLSKRFGQFISSTLPTFAVCEKFVVMEINHEEKPDTGTEE
EFGGLVSANLILLRNRLLDILLKLVYTSKEKTSINLQACEELVRTLGFDWIMMFMEEHLH
STTVTAAMRILVVLLSNQSILIKFKEGLSGGGWLEQTDSVLTNKIGTVLGFNVGRSAGGR
STVREINRDACHFPGFPVLQSFLPKHTNVPALYFLLMALFLQQPVSELPENLQVSVPVVS
SRCKQGCQFDLDSIWTFIFGVPASSGTVVSSIHNVCTEAAFLLLGMLRSMLNSPWQSEEE
GSWLREYPVTLMQFFRYLYHNVPDLASMWMNPDFLCALAATVFPFNIRPYSEMVTDLDDE
VGSPAEEFKAFAADTGMNRSQSEYCNVGVKTYLTNHPAKKFVFDFMRVLIIDNLCLTPAS
KQTPLIDLLLEASPERSTRTQQKEFQTYILDSVMDHLLAADVLLGEDASLPITSGGSYQV
LVNNVFYFTQRVVDKLWQGMFNKESKLLIDFIIQLIAQSKRRSQGLSLDAVYHCLNRTIL
YQFSRAHKTVPQQVALLDSLRVLTVNRNLILGPGNHDQEFISCLAHCLINLHVGSNVDGF
GLEAEARMTTWHIMIPSDIEPDGGYSQDISEGRQLLIKAVNRVWTELIHSKKQVLEELFK
VTLPVNERGHVDIAIARPLIEEASLKCWQNHLAHEKKCISRGEALMPTTQSKLSRVSSGF
GLSKLTGSRRNRKESGLHKHSLSTQEISQWMFTHIAVVRDLVDTQYKEYQERQQNALKYV
TEEWCQIEYELLRERGLWGPPIGSHLDKWMLEMTEGPCRMRKKMVRNDMFYNHYPYVPET
EQETNVAKPARYRRAVSYDSKEYYMRLASGNPAIVQDAIVESSEGEAAQQEPEHGEDTIA
KVKGLVKPPLKRSRSAPDGGDEETQEQLQDQTAEGSSIEEEEKTDNATLLRLLEEGEKIQ
HMYRCARVQGLDTSEGLLLFGKEHFYVIDGFTMTATREIRDIETLPPNMHEPIIPRGARQ
GPSQLKRTCSIFAYEDIKEVHKRRYLLQPIAVEVFSGDGRNYLLAFQKGIRNKVYQRFLA
VVPSLTDSSESVSGQRPNTSVEQGSGLLSTLVGEKSVTQRWERGEISNFQYLMHLNTLAG
RSYNDLMQYPVFPWILADYDSEEVDLTNPKTFRNLAKPMGAQTDERLAQYKKRYKDWEDP
NGETPAYHYGTHYSSAMIVASYLVRMEPFTQIFLRLQGGHFDLADRMFHSVREAWYSASK
HNMADVKELIPEFFYLPEFLFNSNNFDLGCKQNGTKLGDVILPPWAKGDPREFIRVHREA
LECDYVSAHLHEWIDLIFGYKQQGPAAVEAVNVFHHLFYEGQVDIYNINDPLKETATIGF
INNFGQIPKQLFKKPHPPKRVRSRLNGDNAGASVPPGSASDKIFFHHLDNLRPSLTPVKE
LKEPVGQIVCTDKGILAVEQNKVLIPPTWNKTFAWGYADLSCRLGTYESDKAVTVYECLS
EWGQILCAICPNPKLVITGGTSTVVCVWEMSTSKEKAKTLTLKQALLGHTDTVTCATASL
AYHIIVSGSRDRTCIIWDLNKLSFLTQLRGHRAPVSALCINELTGDIVSCAGTYIHVWSI
NGNPVVSVNTFTGRSQQIVCCCVSEMNEWDTQNVIVTGHSDGVVRFWRMEFLQVPETPAP
EPAEVLEMQEDCPEAQIGQEAQDEDSSDSEADEQSVSQDPKDTPSQPSSTSHRPRAASCR
ATATWYNDSGSDDSRRWSDQLSLDEKDGFIFVNYSEGQSRPHLQTPLNHPHPNPIEARNY
SRLKPGYRWERQLVFRSKLTMHTAFDRKDNAHPAEITALGVSKDHSRILVGDSRGRVFSW
SVSDQPGRSAADHWVKDEGGDSCSGCSVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKRL
KISSPVRVCQNCYYNLQHERSSEDGPRNC
Download sequence
Identical sequences F1N6Q9
ENSBTAP00000017949

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]