SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000018010 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000018010
Domain Number 1 Region: 11-150
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.32e-45
Family Galectin (animal S-lectin) 0.00019
Further Details:      
 
Domain Number 2 Region: 221-355
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.06e-42
Family Galectin (animal S-lectin) 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000018010   Gene: ENSBTAG00000013544   Transcript: ENSBTAT00000018010
Sequence length 357
Comment pep:known chromosome:UMD3.1:28:9210587:9239723:1 gene:ENSBTAG00000013544 transcript:ENSBTAT00000018010 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMSLNNLQNVIYNPVIPYVGTISEQLEPGTLIVLRGHVPSDSDRFQVDLQCGSSVKPRAD
VAFHFNPRFKRANCVVCNTLRNEKWGWEEITYDMPFKKEKSFEIVIMVLKEKFQVAVNGR
HTLLYAHRISPERIDTLGIYGKVIIHSVGFSFSSDLGSTQGSTLEPTGISKENVQKSGES
QLPSNRGDISKIVPRTVYTKSKASPANHTLTCAKILPTNCLSKTLPFVARLNSSMGPGRT
IVIKGEVNTNAKGFTVDLLSGKSKDIALHLNPRLNVKAFVRNSFLQEAWGEEERNITCFP
FSPGMYFEMIIYCDAREFKVAVNGVHSLEYKHRFKELSKVDTLEIDGDIHLLEVRSW
Download sequence
Identical sequences Q2YDD7
9913.ENSBTAP00000018010 NP_001039419.1.59421 NP_001039419.1.76553 XP_015316414.1.76553 XP_015316415.1.76553 XP_015316416.1.76553 ENSBTAP00000018010 ENSBTAP00000018010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]