SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000018032 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000018032
Domain Number 1 Region: 6-141
Classification Level Classification E-value
Superfamily UBC-like 1.45e-42
Family UEV domain 0.000000225
Further Details:      
 
Domain Number 2 Region: 324-384
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 3.79e-21
Family VPS23 C-terminal domain 0.0037
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000018032
Domain Number - Region: 237-314
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0022
Family FCH domain 0.049
Further Details:      
 
Domain Number - Region: 151-211
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0204
Family beta-sandwich domain of Sec23/24 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000018032   Gene: ENSBTAG00000013563   Transcript: ENSBTAT00000018032
Sequence length 391
Comment pep:known chromosome:UMD3.1:29:26450457:26492046:1 gene:ENSBTAG00000013563 transcript:ENSBTAT00000018032 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGSESQLKKMVSKYKYRDLTVRETVNVISLYKDLKPVLDSYVFNDGSSRELMNLTGTIP
VPYRGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGKHVDANGKIYLPYLHEWKHP
QSDLLGLIQVMIVVFGDEPPVFSRPTVSASYPPYQATGPPNTSYMPGMPSGISAYPSGYP
PNPSGYTGCPYPPGGQYPATTSSQYPSQPPVTTVGPSRDGTISEDTIRASLISAVSDKLR
WRMKEEMDRAQAELNALKRTEEDLKKGHQKLEEMVNRLDQEVAEVDKNIELLRKKDEELS
SALEKMENQSENNDIDEVIIPTAPLYKQILNLYAEENAIEDTIFYLGEALRRGVIDLDVF
LKHVRLLSRKQFQLRALMQKARKTAGLSDLY
Download sequence
Identical sequences A3KN51 W5PID5
9913.ENSBTAP00000018032 ENSBTAP00000018032 NP_001091464.1.59421 NP_001091464.1.76553 XP_004019512.1.66739 XP_006056130.1.26621 XP_011999268.1.54773 XP_017898931.1.57651 XP_019810553.1.53367 ENSBTAP00000018032 ENSOARP00000010203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]