SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000018076 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000018076
Domain Number 1 Region: 7-152
Classification Level Classification E-value
Superfamily L domain-like 1.04e-29
Family U2A'-like 0.000000393
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000018076   Gene: ENSBTAG00000013593   Transcript: ENSBTAT00000018076
Sequence length 255
Comment pep:known chromosome:UMD3.1:21:29683789:29696818:1 gene:ENSBTAG00000013593 transcript:ENSBTAT00000018076 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGF
PLLRRLKTLLVNNNRICRIGEGLDQALPCLTELILTNNSLVELGDLDPLASLKSLTYLSI
LRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIARRSKT
FNPGAGLPTDKKKGGPSPGDVEAIKNAIANASTLAEVERLKGLLQSGQIPGRERRAGPTD
DGEEEMEEDTVANGS
Download sequence
Identical sequences A0A212CSM5 A6H788
ENSBTAP00000018076 NP_001092418.1.59421 NP_001092418.1.76553 XP_006066443.1.26621 XP_010841567.1.44457 XP_017921958.1.57651 XP_019839395.1.53367 XP_020767488.1.74333 9913.ENSBTAP00000018076 ENSBTAP00000018076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]