SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000018083 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000018083
Domain Number 1 Region: 22-131
Classification Level Classification E-value
Superfamily Growth factor receptor domain 9.89e-16
Family Growth factor receptor domain 0.0012
Further Details:      
 
Domain Number 2 Region: 129-181
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000209
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000018083   Gene: ENSBTAG00000013598   Transcript: ENSBTAT00000018083
Sequence length 201
Comment pep:known_by_projection chromosome:UMD3.1:14:58537071:58653100:1 gene:ENSBTAG00000013598 transcript:ENSBTAT00000018083 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDYSHCQGNRWRRSKRASYVSNPICKGCLSCSKDNGCSRCQQKLFFFLRREGMRQYGECL
HSCPSGYYGHRAPDMNRCARCRIENCDSCFSKDFCTKCKVGFYLHRGRCFEECPDGFAAL
DETMECVEGCEVGHWSEWGTCSRNNRTCGFKWGLETRTRQIVKKPAKDTIPCPTIAESRR
CKMAMRHCPGGRKPDNNIGKK
Download sequence
Identical sequences F6RLD1
ENSBTAP00000018083 ENSBTAP00000018083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]