SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000018145 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000018145
Domain Number 1 Region: 321-378
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 1.39e-22
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.0000596
Further Details:      
 
Domain Number 2 Region: 11-53
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.0000000000000146
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000018145   Gene: ENSBTAG00000013652   Transcript: ENSBTAT00000018145
Sequence length 378
Comment pep:known_by_projection chromosome:UMD3.1:10:93617616:93677055:-1 gene:ENSBTAG00000013652 transcript:ENSBTAT00000018145 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRRLLEPTKKKPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLMQSRAVDG
FHSEEQQLLLQVQQQHQPQQQQHHHHHHHQQAQPQQTVPQQAQAQQVLIPASQQAAAPQV
IVPDSKLIQHMNASNMSAAATAATLALPAGVTPVQQILTNSGQLLQVVRAANGAQYIFQP
QQSVVLQQQVIPQMQPGGVQAPVIQQVLAPLPGGISPQTGVIIQPQQILFTGNKTQVIPT
TVAAPTPAQAQITATGQQQPQAQPAQQQAPLVLQVDGTGDTSSEEDEDEEEDYDDDEEED
KEKDGAEDGQVEEEPLNSEDDVSDEEGQELFDTENVVVCQYDKIHRSKNKWKFHLKDGIM
NLNGRDYIFSKAIGDAEW
Download sequence
Identical sequences F1MII0
ENSBTAP00000018145 ENSBTAP00000018145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]