SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000018355 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000018355
Domain Number 1 Region: 1-360
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.45e-63
Family L-arabinose binding protein-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000018355   Gene: ENSBTAG00000013810   Transcript: ENSBTAT00000018355
Sequence length 835
Comment pep:known_by_projection chromosome:UMD3.1:8:63840064:64089259:-1 gene:ENSBTAG00000013810 transcript:ENSBTAT00000018355 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QCDNAKGLKAFYDAIKYGPNHLMVFGGVCPSVTSIIAESLQGWNLVQLSFAATTPVLADK
KKYPYFFRTVPSDNAVNPAILKLLKHYQWRRVGTLTQDVQRFSEVRNDLTGVLYGEDIEI
SDTESFSNDPCTSVKKLKGNDVRIILGQFDQNMAAKVFCCAYEENMYGSKYQWIIPGWYE
PSWWEQVHAEANSSRCLRKHLLAAMEGYIGVDFEPLSSKQIKTISGKTPQQYEREYNNKR
SGVGPSKFHGYAYDGIWVIAKTLQRAMETLHASSRHQRIQDFNYTDHTLGKIILNAMNET
NFFGVTGQVVFRNGERMGTIKFTQFQDSREVKVGEYNAVAATITHMGESLRAQGSEPPKD
KTIILEQLRKISLPLYSILSALTILGMIMASAFLFFNIKNRNQKLIKMSSPYMNNLIILG
GMLSYASIFLFGLDGSFVSEKTFETLCTVRTWILTVGYTTAFGAMFAKTWRVHAIFKNVK
MKKKIIKDQKLLVIVGGMLLIDLCILICWQAVDPLRRTVERYSMEPDPAGRDISIRPLLE
HCENTHMTIWLGIVYAYKGLLMLFGCFLAWETRNVSIPALNDSKYIGMSVYNVGIMCIIG
AAVSFLTRDQPNVQFCIVALVIIFCSTITLCLVFVPKLITLRTNPDAATQNRRFQFTQNQ
KKEDSKTSTSVTSVNQASTSRLEGLQSENHRLRMKITELDKDLEEVTMQLQDTPEKTTYI
KQNHYQELNDILNLGNFTESTDGGKAVLKNHLDQNPQLQWNTTEPSRTCKDPIEDINSPE
HIQRRLSLQLPILHHAYLPSIGGVDASCVSPCVSPTASPRHRHVPPSFRVMVSGL
Download sequence
Identical sequences F1MIZ5
ENSBTAP00000018355 ENSBTAP00000018355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]