SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000018376 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000018376
Domain Number 1 Region: 12-203
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.45e-58
Family Allantoicase repeat 0.00012
Further Details:      
 
Domain Number 2 Region: 212-388
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.44e-47
Family Allantoicase repeat 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000018376   Gene: ENSBTAG00000013838   Transcript: ENSBTAT00000018376
Sequence length 412
Comment pep:known chromosome:UMD3.1:8:112837179:112860706:-1 gene:ENSBTAG00000013838 transcript:ENSBTAT00000018376 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADSPREGKVARPPDFTQLIDLASEFVGGKILFATDDFFAPAENLLKRDNPSFKEHEYTE
FGKWMDGWQTRRKRIPGHDWCVVQLGIQGVIRGFDVDTSYFTGDHAPRVSIQAANFEEDK
QPEIPQREVRTGAAATPEEFEAISELKSDDWSCLVPMTELTPGNPASSHNYFPVTSQQRW
SHIRLNIFPDGGIARLRVYGTGQKDWTAGDPKEPLDLVTVAYGGACVGFSNAHFGHPNNL
IGVGTATSMADGWETARRLDRPPILENDENGILLVPGCEWAVFRLAHPGVITQIEIDTKY
FKGNSPESCKVDGCILTTQEEEDMVRQKWDLPGHKWKPLLPVTKLKPDEMHVLDSLTPEL
QDVITHAKFTITPDGGVSRLRLKGFPSSICLLRPREKPMMRFSVKAGFRANL
Download sequence
Identical sequences Q2KIG4
NP_001069377.1.59421 NP_001069377.1.76553 ENSBTAP00000018376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]