SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000018394 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000018394
Domain Number 1 Region: 44-241
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.13e-22
Family Clostridium neurotoxins, the second last domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000018394   Gene: ENSBTAG00000013848   Transcript: ENSBTAT00000018394
Sequence length 487
Comment pep:known chromosome:UMD3.1:17:47028031:47202358:-1 gene:ENSBTAG00000013848 transcript:ENSBTAT00000018394 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKLLPLCCWHSWLLLFYCDFQVRGAHTRSHVHPGFEVLASASHYWPLENVDGIHELQET
TGDIVEGKVNKGIYLKEGKGVTFLYYRKNKTSCISNPAQCGPEGVSFSFFWKTQGEQSTS
IPSAYGGQVISNGFKVCSRGGKGSVELYTHNKSVTWEASFSPPGHYWTHVLFTWKSEEGL
KVYVNGTLRTSDPSGKASPAYGESNDNLVLDLTKSYENRAFDEFIIWERALTPDEIAMYF
TAAIGEQLSLSSTPPSFSVTPTVNTMAPTNAYHPIITNLTEERKNFRRPGVVLSYLQNMS
LSLPNKSLSEETAFNLTKTFLNTVGEVLRLPSWTAVSEDSAVVPGLIDTIDTVMSHITYN
LQASKPQVAIVGSSSMADFSVAKVLPKTMNSSHYRFPARGQNYIEIPHEAFHSQAWTTIV
GLLYHSVHYYLSNIQPASTKIAEAANYKNCLLSATSYLISLEVSPTPKLSQNLSGSPLIT
VHLRHHL
Download sequence
Identical sequences G8JKX2
ENSBTAP00000018394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]