SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000018452 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000018452
Domain Number 1 Region: 403-534
Classification Level Classification E-value
Superfamily CalX-like 7.98e-37
Family CalX-beta domain 0.000000188
Further Details:      
 
Domain Number 2 Region: 534-688
Classification Level Classification E-value
Superfamily CalX-like 4.84e-31
Family CalX-beta domain 0.000000173
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000018452   Gene: ENSBTAG00000013861   Transcript: ENSBTAT00000018452
Sequence length 934
Comment pep:known chromosome:UMD3.1:11:22443220:22797877:-1 gene:ENSBTAG00000013861 transcript:ENSBTAT00000018452 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQFSLSPTLSMGFHVIAMVALLFSHVDHISAETEMEGEGNETGECTGSYYCKKGVILPI
WEPQDPSFGDKIARATVYFVAMVYMFLGVSIIADRFMSSIEVITSQEKEITIKKPNGETT
KTTVRIWNETVSNLTLMALGSSAPEILLSVIEVCGHNFTAGDLGPSTIVGSAAFNMFIII
ALCVYVVPDGETRKIKHLRVFFVTAAWSIFAYTWLYIILSVSSPGVVEVWEGLLTFFFFP
ICVVFAWVADRRLLFYKYVYKRYRAGKQRGMIIEHEGDRPSSKTEIEMDGKVVNSHVDSF
LDGALVLEVDERDQDDEEARREMARILKELKQKHPEKEIEQLIELANYQVLSQQQKSRAF
YRIQATRLMTGAGNILKRHAADQARKAVSMHEVNTEVAENDPVSKIFFEQGTYQCLENCG
TVALTIIRRGGDLTNTVFVDFRTEDGTANAGSDYEFTEGTVVFKPGETQKEIRVGIIDDD
IFEEDENFLVHLSNVKVSLEASEDGILEASHVSTLACLGSPSTATVTIFDDDHAGIFTFE
EPVTHVSESIGIMEVKVLRTSGARGNVIVPYKTIEGTARGGGEDFEDTCGELEFQNDEIV
KIITIRIFDREEYEKECSFSLVLEEPKWIRRGMKGGFTITDEYDDKQPLTSKEEEERRIA
EMGRPILGEHTRLEVIIEESYEFKSTVDKLIKKTNLALVVGTNSWREQFIEAITVSAGED
DDDDECGEEKLPSCFDYVMHFLTVFWKVLFAFVPPTEYWNGWACFIVSILMIGLLTAFIG
DLASHFGCTIGLKDSVTAVVFVALGTSVPDTFASKVAATQDQYADASIGNVTGSNAVNVF
LGIGVAWSIAAIYHAANGEQFKVSPGTLAFSVTLFTIFAFINVGVLLYRRRPEIGGELGG
PRTAKLLTSCLFVLLWLLYIFFSSLEAYCHIKGF
Download sequence
Identical sequences A8E655
ENSBTAP00000018452 XP_005212624.1.76553 XP_019825607.1.53367 XP_019825608.1.53367 XP_019825609.1.53367 XP_019825610.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]