SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000018469 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000018469
Domain Number 1 Region: 21-223
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.39e-45
Family Pentraxin (pentaxin) 0.0000000914
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000018469   Gene: ENSBTAG00000013907   Transcript: ENSBTAT00000018469
Sequence length 224
Comment pep:known chromosome:UMD3.1:3:10100406:10104524:1 gene:ENSBTAG00000013907 transcript:ENSBTAT00000018469 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERLLWCFLVLISFSSVSGQTDLHKKAFVFPKETENSYVSLKTQLRTPLKAFTVCLYFYT
ELARTHSYSIFSYATKQQPNEILIFWSKGKGYIFGVHGKQVLFQSPENTQAPTHICASWE
STSGIAELWVNGKPRMRKSLEKGAILGTEASIILGQEQDAFAGGFDRNQCLVGDIGDVNM
WDFVLSPEEINAVYLGSTLSPNVLNWQALNYEAKGEVFIKPQLW
Download sequence
Identical sequences C4T8B4 L8HY07
NP_001137569.1.59421 NP_001137569.1.76553 XP_005906177.1.15283 XP_010845159.1.44457 XP_019843940.1.53367 ENSBTAP00000018469 ENSBTAP00000018469 9913.ENSBTAP00000018469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]