SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000018523 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000018523
Domain Number 1 Region: 348-559
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.73e-30
Family Fungal lipases 0.006
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000018523
Domain Number - Region: 279-325
Classification Level Classification E-value
Superfamily DNA-glycosylase 0.0942
Family Mismatch glycosylase 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000018523   Gene: ENSBTAG00000013942   Transcript: ENSBTAT00000018523
Sequence length 1041
Comment pep:known_by_projection chromosome:UMD3.1:29:40857731:40883995:1 gene:ENSBTAG00000013942 transcript:ENSBTAT00000018523 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGIVVFRRRWSVGSDDLVLPAIFLFLLHTTWFVILSVVLFGLVYNPDEACSLNLVDHGR
GYLGILLSCMIAEMAIIWLSMRGGILYTEPRESMQYVLYVRLAILVIEFIYAIVGIVWLT
QYYTSCNDLTAKNVTLGMVVCNWVVILSVCITVLCVFDPTGRTFVKLRATKRRQRNLRTY
NLRHRLEEGQATSWSRRLKVFLCCTRTKDSQSDAYSEIAYLFAEFFRDLDIVPSDIIAGL
VLLRQRQRAKRNAVLDEANNDILAFLSGMPVTRNTKYLDLKNSHEMLRYKEVCYYMLFAL
AAYGWPMYLMRKPACGLCQLARSCSCCLCPARPRFAPGVTIEEDNCCGCNAIAIRRHFLD
ENMTAVDIVYTSCHDAVYETPFYVAVDHDKKKVVISIRGTLSPKDALTDLTGDAERLPVE
GHHGTWLGHKGMVLSAEYIKKKLEQEMVLSQAFGRDLGRGTKHYGLIVVGHSLGAGTAAI
LSFLLRPQYPTLKCFAYSPPGGLLSEDAMEYSKEFVTAVVLGKDLVPRIGLSQLEGFRRQ
LLDVLQRSTKPKWRIIVGATKCIPKSELPEEVEVTTLASTRLWTHPSDLTIALSASTPLY
PPGRIIHVVHNHPAEQCCCCEQEEPTYFAIWGDNKAFNEVIISPAMLHEHLPYVVMEGLN
KVLENYNKGKTALLSAAKVMVSPTEVDLTPELIFQQQPLPTGPPVPAGLALELPAADHRN
SSIRSKSQSEMSLEGFSEGRLLSPVAAASAARQDPVELLLLSTQERLAAELQARRAPLAT
MESLSDTESLYSFDSRRSSGFRSIRGSPSLHAVLERDEGHLFYIDPAIPEENPSLSSRTE
LLAADSLSKHSQDTQPLEAALGSGGVTPERPPSAAANEEPEEGGGGAAPRSGELALQEGR
LGDSPSPQVLEFAEFIDSLFNLDSKSSSFQDLYCMVVPESPTSDYAEGPKSPSQQEILLR
AQFEPNLVPKPPRLFAGSADPSSGISLSPSFPLSSSGELMDLTPTGLSSQECLAVDKVRT
STPAGRGASPTKQDDLVISAR
Download sequence
Identical sequences E1BBV2
9913.ENSBTAP00000018523 ENSBTAP00000018523 ENSBTAP00000018523 NP_001179512.1.59421 NP_001179512.1.76553 XP_005226987.1.76553 XP_005226988.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]