SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000018634 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000018634
Domain Number 1 Region: 509-710
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-20
Family SPRY domain 0.0063
Further Details:      
 
Domain Number 2 Region: 204-267
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 2.29e-16
Family B-box zinc-binding domain 0.00098
Further Details:      
 
Domain Number 3 Region: 431-514
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000019
Family Fibronectin type III 0.0025
Further Details:      
 
Domain Number 4 Region: 25-64,112-147
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000114
Family RING finger domain, C3HC4 0.026
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000018634
Domain Number - Region: 149-199
Classification Level Classification E-value
Superfamily RING/U-box 0.0459
Family ZZ domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000018634   Gene: ENSBTAG00000014027   Transcript: ENSBTAT00000018634
Sequence length 729
Comment pep:known chromosome:UMD3.1:10:3921477:3962283:-1 gene:ENSBTAG00000014027 transcript:ENSBTAT00000018634 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSESGEVSEFGYIMELLARGKVTIKNIERELICPACKELFTHPLILPCQHSICHKCVKEL
LLMLDDSFNDVGSDNSNQSSPRLRLPSPSVDKIDRISRPGWKRNSLTPRTTTFPCPGCEH
DVDLGERGINGLFRNFTLETIVERYRQAARAATAIMCDLCKPPPQESTKSCMDCSASYCN
ECFKIYHPWGTVKAQHEYVGPTTNFRPKILMCPEHETERINMYCELCRRPVCHLCKLGGN
HSNHRVTTMSSAYKTLKEKLSKDIDYLIGKESQVKSQISELNLLMKETECNGERAKEDAI
IHFEKLFEILEDRKSSVLKAIDASKKLRLDKFQTQMEEYQGLLENNGLVGYAQEVLKETD
QSCFVQTAKQLHVRIQKATESLKSFRPAAQTSFEDYVVNTSKQTELLGELSFFSSGVDVP
EINEEQSKVYNNALINWHHPEKDKADSYVLEYRKINRDEEMLSWNEIEVSGTSKVISDLE
SNCNYAFRVRAYKGSICSPCSRELILHTPPAPVFSFLFDEKCGYNNEHLLLNLKRDRVES
RAGFNLLLAAERIQVGYYTSLDYIIGDVGITKGKHFWAFRVEPYSYLVKAGVASSDKLQE
WLRSPRDAVSPRYEQDSGHDSGSEDACVDSSQPFTLVTIGMKKVFIPKSPTSSNEPENRV
LPMPTSIGVFLDYDKGKVAFYDMDHMKCLYERQVDCSHTMYPAFALMGSGGIQLEESITA
KYLEYQENM
Download sequence
Identical sequences E1BAW5
9913.ENSBTAP00000018634 ENSBTAP00000018634 ENSBTAP00000018634 NP_001193655.1.59421 NP_001193655.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]