SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000018658 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000018658
Domain Number 1 Region: 4-165,349-567
Classification Level Classification E-value
Superfamily L domain-like 4.76e-41
Family Leucine rich effector protein YopM 0.059
Further Details:      
 
Domain Number 2 Region: 632-777
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 9.42e-39
Family Toll/Interleukin receptor TIR domain 0.00000084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000018658   Gene: ENSBTAG00000014042   Transcript: ENSBTAT00000018658
Sequence length 812
Comment pep:known chromosome:UMD3.1:6:59670233:59677223:-1 gene:ENSBTAG00000014042 transcript:ENSBTAT00000018658 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRYIRSIYIFCSIVTSVRSGASELPEERELTTNFSSMSLTKVPEGLTPITTTLDLSYNLL
FQLQHSDFRSLSKLKVLILCHNRIQELDIKTFEFNKELSYLDVSNNRLKSVTWFSLAGLR
HLDLSFNDFDTLPISVETGNMSHLETLGLSGAKIQKSDFQKIAHLQLNTVLLGLRTLSHY
EEGSLPILNTTRLHIVLPVNTNFWVLLHDGIKTSKILEVINIDLQKSQFTSYESQQIPIL
ENAKTSILLLNKVDLSWDDLFLIFQLVWHTSVEYFQIQHVTFGGKVYLDHNSFDYSNTVM
RTIKLEHVHFRIFNIPQESIYLLFTKMDIENLTISDAQMPHMLFPMYPTRFQYLNFANNI
LTDDVFKKSIQLPHLKTLILKDNKLETLSLVSHFASNTSLRHLDLSENLLQHENDENCLW
PETLVTMNLSFNKFADSVFGCLPRNIQILDLNSNKIQTVPKAITHLTSLRELNLAFNFLT
DLPGCSHFRRLLVLNVEMNLILSSSLDFFQSCQEVKTLNAGRNPFRCTCELRDFIQLGKY
SEGMMVGWSDSYICEYPLNLKGTQLKDVHLPEISCNTGLLIVTIVVVMLVLGMAVAFCCL
HFDLPWYLRMLHQWTQTWLRVRKTTQEQLKRSVQFHVFISYSEHDSAWVKYELIPSLEKE
DGSVLICLHEGNSDPGKSMTEDTINCIEKSYKSIFVLSPSFVQTEWCHYEPYFAHHNLFH
ESLDYIILILLEPIPLYCIPTRYPELKALMEKKAYLEWPKDRRKCGLFWANLRAALHVNL
LDTRGTCELQTFTELNEGFGGSAISLIRTDCL
Download sequence
Identical sequences Q6GV17
ENSBTAP00000018658 ENSBTAP00000018658 NP_001070386.1.59421 NP_001070386.1.76553 9913.ENSBTAP00000018658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]