SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000018697 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000018697
Domain Number 1 Region: 9-190
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1e-33
Family Laminin G-like module 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000018697   Gene: ENSBTAG00000014072   Transcript: ENSBTAT00000018697
Sequence length 257
Comment pep:novel chromosome:UMD3.1:11:33348437:33349207:-1 gene:ENSBTAG00000014072 transcript:ENSBTAT00000018697 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTALLQRGGCFLLCLSLLLLGCWAELGSGLEFPGAEGQWTRFPKWNACCESEMSFQLKT
RSARGLVLYFDDEGFCDFLELILTRGGRLQLSFSIFCAEPATLLTDTPVNDGAWHNVRIR
RQFRNTTLFIDQVEAKWVEVKSKRRDMTVFSGLFVGGLPPELRAAALKLTLASVREREPF
KGWIRDVRVNSSLALPVDSGEVKLDDEPPNSGGGSPCEAGEEGEGGVCLNGGVCSVVDDQ
AVCDCSRTGFRGKDCSQ
Download sequence
Identical sequences E1B9N2
ENSBTAP00000018697 ENSBTAP00000018697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]