SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000018719 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000018719
Domain Number 1 Region: 150-258
Classification Level Classification E-value
Superfamily Immunoglobulin 3.11e-17
Family I set domains 0.021
Further Details:      
 
Domain Number 2 Region: 33-115
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000118
Family Growth factor receptor domain 0.0025
Further Details:      
 
Domain Number 3 Region: 102-147
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000111
Family Ovomucoid domain III-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000018719   Gene: ENSBTAG00000014078   Transcript: ENSBTAT00000018719
Sequence length 274
Comment pep:known chromosome:UMD3.1:8:62900199:62917124:-1 gene:ENSBTAG00000014078 transcript:ENSBTAT00000018719 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRSPGLFLLLLVLQPLPALGLGLRSAGGRNPECGPCRPERCPEPVRCPVPGIVARDECG
CCALCLGAEGASCGGRAGARCGPGLVCASRAAGAAPEGTGLCVCAQRGSVCGSDGRSYPS
VCALRLRARQAPRALPGHLHKARDGPCEFAPVVITPPQSVHNVTGAQVYLSCEVRAVPTP
VVTWRKVTRSPEGTQVMEELPGDHTNIAVQVQGGPSDHEATAWVLINPLRKEDEGVYQCH
SANAVGEAQSHGTVTVVDRSQYRAPRFPAPDDRL
Download sequence
Identical sequences A5PKD8
NP_001092631.1.59421 NP_001092631.1.76553 ENSBTAP00000018719 ENSBTAP00000018719 9913.ENSBTAP00000018719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]