SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000018722 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000018722
Domain Number 1 Region: 32-267
Classification Level Classification E-value
Superfamily L domain-like 6.8e-37
Family Ngr ectodomain-like 0.003
Further Details:      
 
Domain Number 2 Region: 279-359
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000144
Family V set domains (antibody variable domain-like) 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000018722   Gene: ENSBTAG00000014083   Transcript: ENSBTAT00000018722
Sequence length 493
Comment pep:known chromosome:UMD3.1:3:34054795:34060289:1 gene:ENSBTAG00000014083 transcript:ENSBTAT00000018722 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPQGDLRGLWLLLLSLFLLLFEVARAGRPVVSCPASCLCASNILSCSKQQLPNVPHSLP
SYTALLDLSHNNLSRLRAEWTPTRLTHLHSLLLSHNHLNFISSEAFSPVPNLRYLDLSSN
QLRTLDEFLFSELQVLEVLLLYNNHIMAVDRCAFDDMTQLQKLYLSQNQISRFPLELVKE
GAKLPKLTLLDLSSNKLKNLPLPDLQKLPAWIKNGLYLHNNPLHCDCELYQLFSHWQYRQ
LSSVMDFQEDLYCMSSKKLHNVFNLSFLNCSEYKERAWEAHLGDSLTIKCDTKQQGMTKV
WVTPSNERVLDEVANSTVTVSKDGSLHFQQVQIEHGGVYTCYAMGEAFNETLSVELKVYN
FTLHGHHDTLNTAYTTLVGCILSVVLVLIYLYLTPCRCWCRGVEKPSSHQADSLSSSMLS
TTPNHDPMAGGDKDDGFDRRVAFLEPAGPAQGQNGKLKPGNTLPVPEATGKGQRRMSDPE
SVSSVFSDTPIVV
Download sequence
Identical sequences A7MBK2 L8IU62
ENSBTAP00000018722 NP_001094589.1.59421 NP_001094589.1.76553 XP_005891372.1.15283 XP_006052251.1.26621 XP_010829211.1.44457 ENSBTAP00000018722 9913.ENSBTAP00000018722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]