SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000018774 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000018774
Domain Number 1 Region: 59-568
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 6.47e-195
Family Myeloperoxidase-like 0.0000000000000144
Further Details:      
 
Domain Number 2 Region: 19-56
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000571
Family EGF-type module 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000018774   Gene: ENSBTAG00000014127   Transcript: ENSBTAT00000018774
Sequence length 604
Comment pep:known chromosome:UMD3.1:16:69263776:69271399:-1 gene:ENSBTAG00000014127 transcript:ENSBTAT00000018774 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLARALLLCAAVALSGAANPCCSHPCQNRGVCMSVGFDQYKCDCTRTGFYGENCTTPEFL
TRIKLLLKPTPNTVHYILTHFKGVWNIVNKISFLRNMIMRYVLTSRSHLIESPPTYNVHY
SYKSWEAFSNLSYYTRALPPVPDDCPTPMGVKGRKELPDSKEVVKKVLLRRKFIPDPQGT
NLMFAFFAQHFTHQFFKTDFERGPAFTKGKNHGVDLSHIYGESLERQHKLRLFKDGKMKY
QMINGEMYPPTVKDTQVEMIYPPHVPEHLKFAVGQEVFGLVPGLMMYATIWLREHNRVCD
VLKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQFQYQ
NRIAAEFNTLYHWHPLLPDVFQIDGQEYNYQQFIYNNSVLLEHGLTQFVESFTRQRAGRV
AGGRNLPVAVEKVSKASIDQSREMKYQSFNEYRKRFLLKPYESFEELTGEKEMAAELEAL
YGDIDAMEFYPALLVEKPRPDAIFGETMVEAGAPFSLKGLMGNPICSPEYWKPSTFGGEV
GFKIINTASIQSLICSNVKGCPFTSFSVQDTHLTKTVTINASSSHSGLDDINPTVLLKER
STEL
Download sequence
Identical sequences F1MNI5 L8IA31
ENSBTAP00000018774 ENSBTAP00000018774 9913.ENSBTAP00000018774 XP_005901335.1.15283 XP_010811841.1.76553 XP_010851368.1.44457 XP_019832459.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]