SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000018789 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000018789
Domain Number 1 Region: 159-543
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.81e-159
Family Myotubularin-like phosphatases 0.0000000000279
Further Details:      
 
Domain Number 2 Region: 35-155
Classification Level Classification E-value
Superfamily PH domain-like 2.09e-41
Family GRAM domain 0.0000183
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000018789   Gene: ENSBTAG00000014138   Transcript: ENSBTAT00000018789
Sequence length 603
Comment pep:known chromosome:UMD3.1:X:33460693:33551321:1 gene:ENSBTAG00000014138 transcript:ENSBTAT00000018789 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASAPTSKYNSHSLENESIKRTSRDGVNRDVGETLPRLPGEIRITDKEVIYICPFNGPIK
GRVYITNYRLYLRSLETDSALILDVPLGVISRIEKMGGATSRGENSYGLDITCKDLRNLR
FALKQEGHSRRDMFEILTRYAFPLAHSLPIFAFLNEEKFNVDGWTVYNPVEEYRRQGLPN
HHWRITFINKCYKLCDTYPALLVVPYRASDEDLRRVATFRSRNRIPVLSWIHPENKTVIV
RCSQPLVGMSGKRNKEDERYLDVIRETNRQVNKLTIYDARPNVNAVANKATGGGYESDDV
YHNAELFFLDIHNIHVMRESLKKVKDIVYPNVEESHWLSSLESTHWLEHIKLVLTGAIQV
ADRVSSGKSSVVVHCSDGWDRTAQLTSLAMLMLDSFYRSIEGFEILVQKEWISFGHKFAS
RIGHGDKNHADADRSPIFLQFIDCVWQMSKQFPTAFEFNERFLITILDHLYSCRFGTFLY
NCESAREKQKVTERTVSLWSLINSNKDKFKNPFYTKEINRVLYPVASMRHLELWVNYYIR
WNPRIKQQQPNPVEQRYMELLALRDEYIKRLDELQLANSAKLSDPSASPSSPSQMMPHVQ
THF
Download sequence
Identical sequences A6QLT4
ENSBTAP00000018789 ENSBTAP00000018789 NP_001193354.1.59421 NP_001193354.1.76553 XP_005889932.1.15283 XP_005962516.1.78601 XP_019811780.1.53367 XP_019811781.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]