SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000018845 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000018845
Domain Number 1 Region: 644-710
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000256
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 2 Region: 564-612
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000209
Family TSP-1 type 1 repeat 0.00062
Further Details:      
 
Domain Number 3 Region: 141-173
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000101
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 4 Region: 24-78
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000222
Family TSP-1 type 1 repeat 0.0028
Further Details:      
 
Domain Number 5 Region: 698-754
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000202
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 6 Region: 80-128
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000124
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000018845   Gene: ENSBTAG00000014177   Transcript: ENSBTAT00000018845
Sequence length 932
Comment pep:known_by_projection chromosome:UMD3.1:20:33328558:33405555:1 gene:ENSBTAG00000014177 transcript:ENSBTAT00000018845 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARHSVLYFILLSALIDKSQACFCDHYPWSQWSSCSKTCNSGTQTRQRRIVTDKYYFENF
CGQLCTKQESRECNWQTCPINCRLGDYGPWSDCDPCVQKRFKVRSILRPSQFGGQPCTEP
LMTFQPCIPSKLCKIEEIDCKNKFRCDSGRCIASKLECNGENDCGDNSDERNCGRKKTVC
SRSHNPIPGVQLMGMGFHFLAGEPRGEVLDNSFTGGVCRTVKSSRASNPYRVPANLENVN
FEVQTKEDDLEADFYDDLIPLEDNKDQEALGSGLATSSFRVPIFYSSKRSQSSSHSSAFK
QAIQASQKKASSFIRIHKVIKVLNFTMKTKDLQLSDVFLKALNHLPLEYNSALYSRIFDD
FGTHYFTSGSLGGVYDLLYQFSKEELKNSGLTQEEAKNCIRIETKKRFLFVKKTKVEHRC
TTNKLSEKYEGSFMQGSEKSISLVQGGRSAYAAALAWEKGSPVPEERVFSDWLESVKENP
SVIDFALAPITDLVRNIPCAVTRRNNLRRAFREYAAKFDPCQCARCPNSGRPVLSGTECL
CVCQSGTYGENCERRSPDYKSNAVDGNWGCWSSWSSCDATYRRSRTRECNNPAPQQGGKR
CEGERRQEEHCTFSIMQNDGQPCISDDEDMKETDLPELESDSGCPQPVPPENGFIRNEKK
QYSVGEEVEILCFTGFKAVGYQYFRCLPDRSWRQGDVECQRTECLKPIVPEGLTLSPFQT
LYKIGDSIELTCPRGLVVNGPSRYTCSGDSWTPPISDSLSCEKDVLTGLRGHCQPGQKQL
GSECVCMSPEEDCGHYSEEICVLDTTSSDYFTSSACKLLAEKCLNNQQLHFVHIGSCEEG
PQLKWGLERIKLSSSSTKNESCGYDTCYNWEKCSATTSKCVCLLPSQCTKGGDQLFCVQI
GSSANGKTMNICEVGAVKCAKREMEILHSGRC
Download sequence
Identical sequences F1MM86
ENSBTAP00000018845 9913.ENSBTAP00000018845 XP_010815084.1.76553 XP_010815085.1.76553 XP_015314559.1.76553 XP_019838608.1.53367 ENSBTAP00000018845

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]